Property Summary

NCBI Gene PubMed Count 33
PubMed Score 58.22
PubTator Score 36.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung adenocarcinoma 2714 1.81535145971503E-6
acute quadriplegic myopathy 1157 1.46729266331113E-5
hepatocellular carcinoma 550 1.75075856338201E-5
ovarian cancer 8492 3.15581799105305E-5
osteosarcoma 7933 1.07586677549969E-4
psoriasis 6685 1.21164827176442E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.44981348857199E-4
medulloblastoma, large-cell 6234 1.68093705593796E-4
Multiple myeloma 1328 2.321219357021E-4
nasopharyngeal carcinoma 1056 2.97010667315608E-4
group 3 medulloblastoma 2254 4.28837844889047E-4
primitive neuroectodermal tumor 3031 4.66541967366009E-4
glioblastoma 5572 0.0012973371440365
pancreatic carcinoma 567 0.001343868501902
pancreatic cancer 2300 0.00134386850190201
gastric cancer 436 0.00136829752044902
pediatric high grade glioma 2712 0.00200110183398071
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00206098490791968
atypical teratoid / rhabdoid tumor 4369 0.00842430789738067
oligodendroglioma 2849 0.0380680909388639
aldosterone-producing adenoma 664 0.0459691331775597
Disease Target Count Z-score Confidence
Alexithymia 14 4.292 2.1
Liposarcoma 20 3.374 1.7

Expression

Synonym

Accession O75494 A6NFM6 A6NI42 A6NIU7 B4DJP9 O60572 Q5JRH9 Q5JRI0 Q5JRI2 Q5JRI3 Q5JRI4 Q96G09 Q96P17
Symbols NSSR
TASR
SRp38
TASR1
TASR2
FUSIP1
FUSIP2
SFRS13
SRrp40
SFRS13A
PPP1R149

Gene

  Ortholog (4)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Xenopus OMA Inparanoid

 GWAS Trait (1)

Gene RIF (10)

PMID Text
26876937 Results show that YTHDC1 promotes exon inclusion in targeted mRNAs through recruiting pre-mRNA splicing factor SRSF3 while blocking SRSF10 mRNA binding.
25091051 SRSF10 is a key regulator of BCLAF1 pre-mRNA splicing and the maintenance of oncogenic features in human colon cancer cells
23166591 Tandem affinity purification and mass spectrometry analysis identify serine/arginine-rich splicing factor 10 (SRSF10), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify serine/arginine-rich splicing factor 10 (SRSF10), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21984158 In colorectal cancer, NSSR1 was highly expressed in the nucleus of tumor cells.
21135127 Splicing thermotolerance is acquired through maintenance of SRSF10 phosphorylation and that this is mediated at least in part by Hsp27.
20232416 Data show that SFRS13A expression was significantly associated with LDLR splicing efficiency in vivo.
16135820 SRp38 contains two arginine- and serine-rich domains (RS), one of which has a unique, second-step repression activity, while both function together as a splicing repression domain.
14765198 SRp38 plays a crucial role in cell survival under stress conditions by inhibiting the splicing machinery
12419250 found to be dephosphorylated specifically in mitotic cells; show that dephosphorylated SRp38 is required for the observed splicing repression

AA Sequence

MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHN      1 - 70
LDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRR     71 - 140
SYSPRNSRPTGRPRRSRSHSDNDRFKHRNRSFSRSKSNSRSRSKSQPKKEMKAKSRSRSASHTKTRGTSK    141 - 210
TDSKTHYKSGSRYEKESRKKEPPRSKSQSRSQSRSRSKSRSRSWTSPKSSGH                      211 - 262
//

Text Mined References (41)

PMID Year Title
26876937 2016 Nuclear m(6)A Reader YTHDC1 Regulates mRNA Splicing.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25091051 2014 BCLAF1 and its splicing regulator SRSF10 regulate the tumorigenic potential of colon cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21984158 2011 [Expression of neural salient serine-/arginine-rich protein 1 (NSSR1) in colorectal cancer].
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...