Property Summary

NCBI Gene PubMed Count 34
PubMed Score 68.11
PubTator Score 36.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute quadriplegic myopathy 1.109 1.5e-05
aldosterone-producing adenoma -1.032 4.6e-02
atypical teratoid / rhabdoid tumor -1.200 8.4e-03
gastric cancer 1.400 1.4e-03
glioblastoma 1.200 1.8e-05
group 3 medulloblastoma 1.400 3.3e-03
hepatocellular carcinoma 1.400 1.8e-05
intraductal papillary-mucinous adenoma (... 1.100 2.1e-03
intraductal papillary-mucinous carcinoma... 1.200 1.4e-04
lung adenocarcinoma 1.205 1.8e-06
medulloblastoma, large-cell 1.200 1.7e-04
Multiple myeloma 1.090 3.8e-03
nasopharyngeal carcinoma 1.400 3.0e-04
oligodendroglioma -1.500 3.8e-02
osteosarcoma 2.195 1.1e-04
ovarian cancer -1.200 4.9e-03
pancreatic cancer 1.500 1.3e-03
pancreatic carcinoma 1.500 1.3e-03
pediatric high grade glioma 1.100 2.0e-03
primitive neuroectodermal tumor 1.300 4.7e-04
psoriasis 1.200 8.1e-03

 GWAS Trait (1)

Gene RIF (11)

AA Sequence

MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHN      1 - 70
LDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRR     71 - 140
SYSPRNSRPTGRPRRSRSHSDNDRFKHRNRSFSRSKSNSRSRSKSQPKKEMKAKSRSRSASHTKTRGTSK    141 - 210
TDSKTHYKSGSRYEKESRKKEPPRSKSQSRSQSRSRSKSRSRSWTSPKSSGH                      211 - 262
//

Text Mined References (42)

PMID Year Title