Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.42
PubTator Score 28.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.900 4.6e-05
astrocytic glioma -1.800 4.5e-03
Astrocytoma, Pilocytic -1.900 1.5e-05
atypical teratoid / rhabdoid tumor -1.500 3.3e-05
ependymoma -2.700 5.0e-03
glioblastoma -2.800 1.4e-09
group 3 medulloblastoma -2.300 8.3e-03
lung carcinoma 1.200 8.9e-29
medulloblastoma, large-cell -3.300 6.5e-05
oligodendroglioma -2.500 1.3e-20
ovarian cancer -1.500 3.6e-12
pituitary cancer 1.300 1.5e-05
primitive neuroectodermal tumor -2.900 1.7e-05
subependymal giant cell astrocytoma -2.804 8.1e-03

AA Sequence

MGAAARLSAPRALVLWAALGAAAHIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWSLCAVGKRQSP      1 - 70
VDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPAPRPVVNVSGGPLLYSHRLSELRLLFGAR     71 - 140
DGAGSEHQINHQGFSAEVQLIHFNQELYGNFSAASRGPNGLAILSLFVNVASTSNPFLSRLLNRDTITRI    141 - 210
SYKNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQI    211 - 280
FQSLSGNSRPLQPLAHRALRGNRDPRHPERRCRGPNYRLHVDGVPHGR                          281 - 328
//

Text Mined References (13)

PMID Year Title