Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.42
PubTator Score 28.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 8.86305937977999E-29
oligodendroglioma 2849 1.32457812096267E-20
ovarian cancer 8492 3.63326697158057E-12
pediatric high grade glioma 2712 1.3081123840156E-7
medulloblastoma 1524 2.18105844449687E-7
pilocytic astrocytoma 3086 1.18404889249201E-5
glioblastoma 5572 1.31664242165413E-5
pituitary cancer 1972 1.5324717236137E-5
primitive neuroectodermal tumor 3031 1.74882027879584E-5
atypical teratoid / rhabdoid tumor 4369 3.298489115905E-5
medulloblastoma, large-cell 6234 6.50753682358849E-5
astrocytoma 1493 3.55853489653124E-4
ependymoma 2514 0.00503882140392387
subependymal giant cell astrocytoma 2287 0.00810933905498821
Disease Target Count Z-score Confidence
Machado-Joseph disease 18 3.024 1.5

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma -4.000 0.000
ependymoma -2.700 0.005
glioblastoma -4.600 0.000
oligodendroglioma -2.500 0.000
medulloblastoma -3.400 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell -3.300 0.000
primitive neuroectodermal tumor -2.900 0.000
pediatric high grade glioma -3.100 0.000
pilocytic astrocytoma -1.900 0.000
subependymal giant cell astrocytoma -2.804 0.008
lung carcinoma 1.200 0.000
ovarian cancer -1.500 0.000
pituitary cancer 1.300 0.000

Synonym

Accession O75493 O60596 Q6FHI1 Q9UEC4
Symbols CARPX1

Gene

PANTHER Protein Class (2)

  Ortholog (11)

AA Sequence

MGAAARLSAPRALVLWAALGAAAHIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWSLCAVGKRQSP      1 - 70
VDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPAPRPVVNVSGGPLLYSHRLSELRLLFGAR     71 - 140
DGAGSEHQINHQGFSAEVQLIHFNQELYGNFSAASRGPNGLAILSLFVNVASTSNPFLSRLLNRDTITRI    141 - 210
SYKNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQI    211 - 280
FQSLSGNSRPLQPLAHRALRGNRDPRHPERRCRGPNYRLHVDGVPHGR                          281 - 328
//

Text Mined References (13)

PMID Year Title
24941225 2014 Genetic variations affecting serum carcinoembryonic antigen levels and status of regional lymph nodes in patients with sporadic colorectal cancer from Southern China.
23300138 2014 A genome wide association study of genetic loci that influence tumour biomarkers cancer antigen 19-9, carcinoembryonic antigen and ? fetoprotein and their associations with cancer risk.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21060863 2010 Four novel Loci (19q13, 6q24, 12q24, and 5q14) influence the microcirculation in vivo.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12044474 2002 Developmental expression of carbonic anhydrase-related proteins VIII, X, and XI in the human brain.
11311946 2001 cDNA sequence of human carbonic anhydrase-related protein, CA-RP X: mRNA expressions of CA-RP X and XI in human brain.
More...