Property Summary

NCBI Gene PubMed Count 34
PubMed Score 434.30
PubTator Score 33.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.235 0.000
osteosarcoma -1.186 0.001
ovarian cancer 1.800 0.000

Synonym

Accession O75489 B2R9J1 B4DFM8 Q9UNQ8
Symbols CI-30

Gene

Gene RIF (12)

PMID Text
25770168 High NDUFS3 expression is associated with IgA nephropathy.
24028823 pH stability of w-t and Leigh syndrome mutant varied at extreme acidic pH. the molten globule like structure of w-t at pH1 was absent in case of the mutant protein. Both the w-t and mutant proteins showed multi-step thermal and Gdn-HCl induced unfolding
23630608 Expressions of GRIM-19, NDUFS3, and extracellular matrix elements are correlated with invasive capabilities of breast cancer cell lines.
23446378 NDUFS3 is down-regulated in serous ovarian adenocarcinoma
21867691 a novel, biomarker potential of a mitochondrial complex I subunit protein, NDUFS3 - as a robust indicator of breast cancer progression and invasiveness as well as of hypoxia/necrosis in clinical specimens of invasive ductal carcinoma, was uncovered.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19034380 This protein has been found differentially expressed in the temporal lobe from patients with schizophrenia.
18977241 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of NADH dehydrogenase (ubiquinone) Fe-S protein 3 (NADH-coenzyme Q reductase, 30kDa; NDUFS3) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
More...

AA Sequence

MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILP      1 - 70
KYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSR     71 - 140
IRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVEL    141 - 210
RYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK                    211 - 264
//

Text Mined References (39)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25770168 2015 Altered monocyte expression and expansion of non-classical monocyte subset in IgA nephropathy patients.
24344204 2014 TIMMDC1/C3orf1 functions as a membrane-embedded mitochondrial complex I assembly factor through association with the MCIA complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24028823 2013 Human mitochondrial NDUFS3 protein bearing Leigh syndrome mutation is more prone to aggregation than its wild-type.
23630608 2013 Suppression of mitochondrial complex I influences cell metastatic properties.
23446378 2013 Reduced expression of NDUFS3 and its clinical significance in serous ovarian cancer.
22926577 2012 Quantitative proteomic analysis of human substantia nigra in Alzheimer's disease, Huntington's disease and Multiple sclerosis.
21867691 2011 Biomarker signatures of mitochondrial NDUFS3 in invasive breast carcinoma.
21269460 2011 Initial characterization of the human central proteome.
More...