Property Summary

NCBI Gene PubMed Count 22
PubMed Score 40.36
PubTator Score 26.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 1.70683787584045E-29
posterior fossa group B ependymoma 1530 6.8133607068359E-15
malignant mesothelioma 3163 1.522610039784E-9
atypical teratoid / rhabdoid tumor 4369 6.558003529138E-7
ovarian cancer 8492 1.56565210490005E-6
lung adenocarcinoma 2714 9.41332079512414E-6
osteosarcoma 7933 2.32425392243801E-5
pediatric high grade glioma 2712 4.79209598355703E-5
lung cancer 4473 6.39926640112203E-5
group 4 medulloblastoma 1875 6.51087137915127E-5
psoriasis 6685 9.88309469125894E-5
Breast cancer 3099 1.10161575657446E-4
glioblastoma 5572 0.00195528932646108
pilocytic astrocytoma 3086 0.00284500680496193
diabetes mellitus 1663 0.00666981965309189
Hydrolethalus syndrome 128 0.0289121523901498
ductal carcinoma in situ 1745 0.0360068131447916
primitive neuroectodermal tumor 3031 0.0485108778005858

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma 6.600 0.000
psoriasis -2.300 0.000
osteosarcoma 2.796 0.000
posterior fossa group B ependymoma 2.500 0.000
atypical teratoid / rhabdoid tumor 2.700 0.000
glioblastoma 1.100 0.002
primitive neuroectodermal tumor 1.600 0.049
Hydrolethalus syndrome -1.298 0.029
lung cancer -3.000 0.000
diabetes mellitus -1.300 0.007
pediatric high grade glioma 1.300 0.000
group 4 medulloblastoma -1.400 0.000
pilocytic astrocytoma 1.100 0.003
lung adenocarcinoma 1.690 0.000
lung carcinoma -1.900 0.000
Breast cancer 1.300 0.000
ductal carcinoma in situ 1.300 0.036
ovarian cancer -1.900 0.000

Synonym

Accession O75487 B2R6J7 B4E2C0 Q6ZMA6 Q96L43 Q9NU08 Q9UJN1 Q9UPD9
Symbols K-glypican

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid

 CSPA Cell Line (3)

Gene RIF (4)

PMID Text
23633195 Data suggest gender difference in circulating GPC4 levels in nonalcoholic fatty liver disease; GPC4 levels in women appear to correlate with cardiometabolic risk factors (adiposity/body fat distribution, insulin resistance, and arterial stiffness).
22761013 Findings establish that Gpc4 acts at the interface of extrinsic and intrinsic signal regulation to fine tune stem cell fate.
22644326 new function of miR-125a by targeting gene glypican-4 in cell growth process
19884766 Glypican 4 (GPC4) is downregulated in HIV-1 Tat and NC cotransfection of HEK 293T cells

AA Sequence

MARFGLPALLCTLAVLSAALLAAELKSKSCSEVRRLYVSKGFNKNDAPLHEINGDHLKICPQGSTCCSQE      1 - 70
MEEKYSLQSKDDFKSVVSEQCNHLQAVFASRYKKFDEFFKELLENAEKSLNDMFVKTYGHLYMQNSELFK     71 - 140
DLFVELKRYYVVGNVNLEEMLNDFWARLLERMFRLVNSQYHFTDEYLECVSKYTEQLKPFGDVPRKLKLQ    141 - 210
VTRAFVAARTFAQGLAVAGDVVSKVSVVNPTAQCTHALLKMIYCSHCRGLVTVKPCYNYCSNIMRGCLAN    211 - 280
QGDLDFEWNNFIDAMLMVAERLEGPFNIESVMDPIDVKISDAIMNMQDNSVQVSQKVFQGCGPPKPLPAG    281 - 350
RISRSISESAFSARFRPHHPEERPTTAAGTSLDRLVTDVKEKLKQAKKFWSSLPSNVCNDERMAAGNGNE    351 - 420
DDCWNGKGKSRYLFAVTGNGLANQGNNPEVQVDTSKPDILILRQIMALRVMTSKMKNAYNGNDVDFFDIS    421 - 490
DESSGEGSGSGCEYQQCPSEFDYNATDHAGKSANEKADSAGVRPGAQAYLLTVFCILFLVMQREWR        491 - 556
//

Text Mined References (22)

PMID Year Title
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
23633195 2013 Association of glypican-4 with body fat distribution, insulin resistance, and nonalcoholic fatty liver disease.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22761013 2012 Modulating Glypican4 suppresses tumorigenicity of embryonic stem cells while preserving self-renewal and pluripotency.
22644326 2012 MicroRNA-125a inhibits cell growth by targeting glypican-4.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...