Property Summary

NCBI Gene PubMed Count 36
PubMed Score 4.62
PubTator Score 14.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... -1.100 1.3e-02
sonic hedgehog group medulloblastoma 1.100 2.5e-06
tuberculosis 1.300 6.7e-06

 MGI Phenotype (1)

Gene RIF (10)

AA Sequence

MYSPRGSQGRGTAEATANSPSPPIAPSHSRVTFSLSTLHTLSPPPRPFPSVSRAAAQKPHHLHPHILLAG      1 - 70
SAAVPPRVLKAEMNNTAASPMSTATSSSGRSTGKSISFATELQSMMYSLGDARRPLHETAVLVEDVVHTQ     71 - 140
LINLLQQAAEVSQLRGARVITPEDLLFLMRKDKKKLRRLLKYMFIRDYKSKIVKGIDEDDLLEDKLSGSN    141 - 210
NANKRQKIAQDFLNSIDQTGELLAMFEDDEIDEVKQERMERAERQTRIMDSAQYAEFCESRQLSFSKKAS    211 - 280
KFRDWLDCSSMEIKPNVVAMEILAYLAYETVAQLVDLALLVRQDMVTKAGDPFSHAISATFIQYHNSAES    281 - 350
TAACGVEAHSDAIQPCHIREAIRRYSHRIGPLSPFTNAYRRNGMAFLAC                         351 - 399
//

Text Mined References (41)

PMID Year Title