Property Summary

NCBI Gene PubMed Count 36
PubMed Score 4.62
PubTator Score 14.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Synonym

Accession O75486 A6NKG9 B2R9Q5 O76066 Q5TAV9 Q86VN7
Symbols SPT3
SPT3L

Gene

PANTHER Protein Class (1)

Gene RIF (10)

PMID Text
25934476 we identified rs41314453 as the main genetic determinant of ADAMTS13 activity, and we present preliminary findings for further associations at the ADAMTS13 and SUPT3H loci.
25860292 significance of the formation PVT1- SUPT3H chimeric gene remains unknown and the overexpression of MYC by ectopic promoter on chromosome 6 may be essential to tumor genesis.
22407027 identified a significant excess of genes with pivotal roles in bone homeostasis, such as PPPT3B and the height associated SUPT3H-RUNX2
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19893584 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19259136 Found evidence of Mendelian Transmission Distortion in the region harboring SUPT3H in one HapMap population.
19259136 Observational study of gene-disease association. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17967894 suggest a novel STAF65gamma-dependent function of STAGA-type complexes in cell proliferation and transcription activation by MYC postloading of TFIID and RNA polymerase II that involves direct recruitment of core Mediator

AA Sequence

MYSPRGSQGRGTAEATANSPSPPIAPSHSRVTFSLSTLHTLSPPPRPFPSVSRAAAQKPHHLHPHILLAG      1 - 70
SAAVPPRVLKAEMNNTAASPMSTATSSSGRSTGKSISFATELQSMMYSLGDARRPLHETAVLVEDVVHTQ     71 - 140
LINLLQQAAEVSQLRGARVITPEDLLFLMRKDKKKLRRLLKYMFIRDYKSKIVKGIDEDDLLEDKLSGSN    141 - 210
NANKRQKIAQDFLNSIDQTGELLAMFEDDEIDEVKQERMERAERQTRIMDSAQYAEFCESRQLSFSKKAS    211 - 280
KFRDWLDCSSMEIKPNVVAMEILAYLAYETVAQLVDLALLVRQDMVTKAGDPFSHAISATFIQYHNSAES    281 - 350
TAACGVEAHSDAIQPCHIREAIRRYSHRIGPLSPFTNAYRRNGMAFLAC                         351 - 399
//

Text Mined References (40)

PMID Year Title
25934476 2015 Genetic variants in the ADAMTS13 and SUPT3H genes are associated with ADAMTS13 activity.
25860292 2015 Identification of SUPT3H as a novel 8q24/MYC partner in blastic plasmacytoid dendritic cell neoplasm with t(6;8)(p21;q24) translocation.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25064007 2014 A genome-wide association study identifies susceptibility loci for ossification of the posterior longitudinal ligament of the spine.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22941190 2012 Common variants at 6p21.1 are associated with large artery atherosclerotic stroke.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...