Property Summary

NCBI Gene PubMed Count 23
PubMed Score 7.79
PubTator Score 79.60

Knowledge Summary

Patent

No data available

Gene RIF (7)

AA Sequence

MDRLGPFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHQSDHTYEIMTSDFPV      1 - 70
LDPSWTAQEEMALLEAVMDCGFGNWQDVANQMCTKTKEECEKHYMKHFINNPLFASTLLNLKQAEEAKTA     71 - 140
DTAIPFHSTDDPPRPTFDSLLSRDMAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKMAVVDI    141 - 210
YHSRLKERQRRKKIIRDHGLINLRKFQLMERRYPKEVQDLYETMRRFARIVGPVEHDKFIESHALEFELR    211 - 280
REIKRLQEYRTAGITNFCSARTYDHLKKTREEERLKRTMLSEVLQYIQDSSACQQWLRRQADIDSGLSPS    281 - 350
IPMASNSGRRSAPPLNLTGLPGTEKLNEKEKELCQMVRLVPGAYLEYKSALLNECNKQGGLRLAQARALI    351 - 420
KIDVNKTRKIYDFLIREGYITKG                                                   421 - 443
//

Text Mined References (27)

PMID Year Title