Property Summary

NCBI Gene PubMed Count 21
PubMed Score 6.73
PubTator Score 79.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 6.3873961008752E-9
glioblastoma 5572 3.87460132752351E-7
malignant mesothelioma 3163 2.62154024892496E-6
atypical teratoid / rhabdoid tumor 4369 1.85580790790911E-5
pediatric high grade glioma 2712 1.03975852951403E-4
lung cancer 4473 6.22654543649353E-4
psoriasis 6685 0.00367456100009755

Synonym

Accession O75478 A8MVD0 B3KMU9 Q9BVJ0 Q9UCW2 Q9UP49
Symbols ADA2
ADA2A
KL04P
hADA2
TADA2L

Gene

PDB

1X41  

  Ortholog (12)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Fruitfly OMA Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (6)

PMID Text
26468280 results thus demonstrate that the catalytic activity of GCN5 is stimulated by subunits of the ADA2a- or ADA2b-containing HAT modules and is further increased by incorporation of the distinct HAT modules in the ATAC or SAGA holo-complexes
25492086 Single nucleotide polymorphism in ADA2 gene is associated with type 1 diabetes.
22644376 CCDC134 increased the PCAF-dependent K320 acetylation of p53 and p53 protein stability in the presence of hADA2a overexpression.
20602615 Observational study of gene-disease association. (HuGE Navigator)
18059173 hADA2a and hADA3 as crucial cofactors of beta-catenin that are likely involved in the assembly of transactivation-competent beta-catenin complexes at Wnt target genes.
16299514 The three-dimensional solution structure of the SWIRM domain from the human transcriptional adaptor ADA2alpha was reported.

AA Sequence

MDRLGPFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHQSDHTYEIMTSDFPV      1 - 70
LDPSWTAQEEMALLEAVMDCGFGNWQDVANQMCTKTKEECEKHYMKHFINNPLFASTLLNLKQAEEAKTA     71 - 140
DTAIPFHSTDDPPRPTFDSLLSRDMAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKMAVVDI    141 - 210
YHSRLKERQRRKKIIRDHGLINLRKFQLMERRYPKEVQDLYETMRRFARIVGPVEHDKFIESHALEFELR    211 - 280
REIKRLQEYRTAGITNFCSARTYDHLKKTREEERLKRTMLSEVLQYIQDSSACQQWLRRQADIDSGLSPS    281 - 350
IPMASNSGRRSAPPLNLTGLPGTEKLNEKEKELCQMVRLVPGAYLEYKSALLNECNKQGGLRLAQARALI    351 - 420
KIDVNKTRKIYDFLIREGYITKG                                                   421 - 443
//

Text Mined References (24)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26468280 2015 Subunits of ADA-two-A-containing (ATAC) or Spt-Ada-Gcn5-acetyltrasferase (SAGA) Coactivator Complexes Enhance the Acetyltransferase Activity of GCN5.
25492086 2015 Genetic factors adaptive in a malarial environment may increase the risk of type 1 diabetes.
25416956 2014 A proteome-scale map of the human interactome network.
23535730 2013 GWAS meta-analysis and replication identifies three new susceptibility loci for ovarian cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22644376 2012 CCDC134 interacts with hADA2a and functions as a regulator of hADA2a in acetyltransferase activity, DNA damage-induced apoptosis and cell cycle arrest.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
19103755 2009 The double-histone-acetyltransferase complex ATAC is essential for mammalian development.
18059173 2008 hADA2a and hADA3 are required for acetylation, transcriptional activity and proliferative effects of beta-catenin.
More...