Property Summary

NCBI Gene PubMed Count 23
PubMed Score 9.42
PubTator Score 8.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.500 2.8e-07
ependymoma 1.400 8.1e-06
gastric cancer -1.100 4.7e-02
Gaucher disease type 1 -1.700 1.7e-02
glioblastoma 2.100 2.8e-03
group 3 medulloblastoma 1.700 2.5e-05
interstitial cystitis -1.100 2.4e-03
intraductal papillary-mucinous neoplasm ... 1.200 3.0e-02
lung cancer 1.100 2.5e-03
medulloblastoma, large-cell 2.700 8.1e-07
osteosarcoma -1.969 9.2e-07
ovarian cancer -1.400 3.3e-06
pediatric high grade glioma 1.400 9.1e-03
primitive neuroectodermal tumor 1.300 3.1e-04
psoriasis 1.100 7.2e-04
urothelial carcinoma -1.100 3.8e-02
Waldenstrons macroglobulinemia 1.488 2.3e-02

Gene RIF (10)

AA Sequence

MTQARVLVAAVVGLVAVLLYASIHKIEEGHLAVYYRGGALLTSPSGPGYHIMLPFITTFRSVQTTLQTDE      1 - 70
VKNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIEL     71 - 140
FDQIDENLKQALQKDLNLMAPGLTIQAVRVTKPKIPEAIRRNFELMEAEKTKLLIAAQKQKVVEKEAETE    141 - 210
RKKAVIEAEKIAQVAKIRFQQKVMEKETEKRISEIEDAAFLAREKAKADAEYYAAHKYATSNKHKLTPEY    211 - 280
LELKKYQAIASNSKIYFGSNIPNMFVDSSCALKYSDIRTGRESSLPSKEALEPSGENVIQNKESTG        281 - 346
//

Text Mined References (31)

PMID Year Title