Property Summary

NCBI Gene PubMed Count 107
Grant Count 162
R01 Count 75
Funding $33,678,913.61
PubMed Score 369.25
PubTator Score 616.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Synonym

Accession O75475 D3DRI9 O00256 O95368 Q6P391 Q86YB9 Q9NZI3 Q9UER6
Symbols p52
p75
PAIP
DFS70
LEDGF
PSIP2

Gene

PDB

2N3A   1Z9E   2B4J   2M16   2MSR   2MTN   3F9K   3HPG   3HPH   3U88   3ZEH   4FU6  

Gene RIF (478)

PMID Text
26771192 LEDGF/p75 Overexpression Attenuates Oxidative Stress-Induced Necrosis and Upregulates the Oxidoreductase ERP57/PDIA3/GRP58 in Prostate Cancer
26545813 LEDGF/p75 interacts with splicing factors, contributes to exon choice, and directs HIV-1 integration to transcription units that are highly spliced.
26245978 common LEDGF/p75 interaction interface shared by JPO2, PogZ, MLL1, IWS1 and HIV IN
26245978 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
26245978 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
26245978 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
26245978 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
26245978 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
26245978 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
26245978 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
More...

AA Sequence

MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIFPYSENKEKYGK      1 - 70
PNKRKGFNEGLWEIDNNPKVKFSSQQAATKQSNASSDVEVEEKETSVSKEDTDHEEKASNEDVTKAVDIT     71 - 140
TPKAARRGRKRKAEKQVETEEAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDI    141 - 210
ITEEDKSKKKGQEEKQPKKQPKKDEEGQKEEDKPRKEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGD    211 - 280
DQEGEKKRKGGRNFQTAHRRNMLKGQHEKEAADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDS    281 - 350
RLQRIHAEIKNSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLY    351 - 420
NKFKNMFLVGEGDSVITQVLNKSLAEQRQHEEANKTKDQGKKGPNKKLEKEQTGSKTLNGGSDAQDGNQP    421 - 490
QHNGESNEDSKDNHEASTKKKPSSEERETEISLKDSTLDN                                  491 - 530
//

Text Mined References (125)

PMID Year Title
26771192 2016 LEDGF/p75 Overexpression Attenuates Oxidative Stress-Induced Necrosis and Upregulates the Oxidoreductase ERP57/PDIA3/GRP58 in Prostate Cancer.
26545813 2015 LEDGF/p75 interacts with mRNA splicing factors and targets HIV-1 integration to highly spliced genes.
26245978 2015 Multiple cellular proteins interact with LEDGF/p75 through a conserved unstructured consensus motif.
26235378 2015 Specificity of antinuclear autoantibodies recognizing the dense fine speckled nuclear pattern: Preferential targeting of DFS70/LEDGFp75 over its interacting partner MeCP2.
25809198 2015 HIV-1 IN/Pol recruits LEDGF/p75 into viral particles.
25590759 2015 The integrase cofactor LEDGF/p75 associates with Iws1 and Spt6 for postintegration silencing of HIV-1 gene expression in latently infected cells.
25305204 2014 The same site on the integrase-binding domain of lens epithelium-derived growth factor is a therapeutic target for MLL leukemia and HIV.
25231459 2014 Identification of novel nuclear targets of human thioredoxin 1.
25082813 2014 Validation and structural characterization of the LEDGF/p75-MLL interface as a new target for the treatment of MLL-dependent leukemia.
25047784 2014 Association of single nucleotide polymorphisms in the lens epithelium-derived growth factor (LEDGF/p75) with HIV-1 infection outcomes in Brazilian HIV-1+ individuals.
More...