Property Summary

NCBI Gene PubMed Count 112
PubMed Score 391.22
PubTator Score 616.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -1.500 9.6e-03
astrocytic glioma -1.800 4.0e-02
atypical teratoid / rhabdoid tumor -2.100 9.7e-07
dermatomyositis 1.200 1.3e-03
Down syndrome 1.100 4.2e-04
ependymoma -1.200 1.1e-03
glioblastoma -2.200 9.9e-05
group 3 medulloblastoma 1.200 9.0e-03
hepatocellular carcinoma -1.100 2.8e-03
invasive ductal carcinoma -1.200 2.8e-03
lung adenocarcinoma -1.500 1.1e-09
lung cancer 1.300 4.2e-04
malignant mesothelioma -4.200 1.9e-07
medulloblastoma, large-cell -2.100 4.5e-06
ovarian cancer -1.500 5.6e-04
primary Sjogren syndrome 1.200 4.1e-03
progressive supranuclear palsy -1.400 1.6e-02
psoriasis -1.100 7.8e-08
tuberculosis and treatment for 6 months 1.100 2.0e-04
Waldenstrons macroglobulinemia 1.166 1.9e-02

Gene RIF (251)

AA Sequence

MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIFPYSENKEKYGK      1 - 70
PNKRKGFNEGLWEIDNNPKVKFSSQQAATKQSNASSDVEVEEKETSVSKEDTDHEEKASNEDVTKAVDIT     71 - 140
TPKAARRGRKRKAEKQVETEEAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDI    141 - 210
ITEEDKSKKKGQEEKQPKKQPKKDEEGQKEEDKPRKEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGD    211 - 280
DQEGEKKRKGGRNFQTAHRRNMLKGQHEKEAADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDS    281 - 350
RLQRIHAEIKNSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLY    351 - 420
NKFKNMFLVGEGDSVITQVLNKSLAEQRQHEEANKTKDQGKKGPNKKLEKEQTGSKTLNGGSDAQDGNQP    421 - 490
QHNGESNEDSKDNHEASTKKKPSSEERETEISLKDSTLDN                                  491 - 530
//

Text Mined References (131)

PMID Year Title