Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.50
PubTator Score 5.34

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 2.000 0.000
osteosarcoma -2.155 0.001
ovarian cancer 1.100 0.000
pituitary cancer 1.200 0.000

Synonym

Accession O75474 Q5JTI0 Q8WUL9 Q9BYG2
Symbols

Gene

 MGI Term (1)

Gene RIF (3)

PMID Text
20613673 Observational study of gene-disease association. (HuGE Navigator)
17433504 It suggests that activation of GSK-3 inhibits PP-2A through up-regulation of I(2)(PP-2A) with hnRNP A18-involved mechanism.
15522877 FRAT-2 enhances glycogen synthase kinase 3 beta-mediated phosphorylation of a primed substrate to a greater extent than an unprimed substrate

AA Sequence

MPCRREEEEEAGEEAEGEEEEDDSFLLLQQSVTLGSSGEVDRLVAQIGETLQLDAAQDSPASPCAPPGVP      1 - 70
LRAPGPLAAAVPADKARPPAVPLLLPPASAETVGPAPSGALRCALGDRGRVRGRAAPYCVAEVAAGPSAL     71 - 140
PGPCRRGWLRDAVTSRRLQQRRWTQAGARAGDDDPHRLLQQLVLSGNLIKEAVRRLQRAVAAVAATGPAS    141 - 210
APGPGGGRSGPDRIALQPSGSLL                                                   211 - 233
//

Text Mined References (11)

PMID Year Title
20613673 Association between polymorphisms in Wnt signaling pathway genes and bone mineral density in postmenopausal Korean women.
17433504 2008 Activation of glycogen synthase kinase-3 inhibits protein phosphatase-2A and the underlying mechanisms.
15522877 2005 FRAT-2 preferentially increases glycogen synthase kinase 3 beta-mediated phosphorylation of primed sites, which results in enhanced tau phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12095675 2002 Characterization and tissue-specific expression of human GSK-3-binding proteins FRAT1 and FRAT2.
11738041 2001 The structure of phosphorylated GSK-3beta complexed with a peptide, FRATtide, that inhibits beta-catenin phosphorylation.
11237732 2001 Molecular cloning and characterization of FRAT2, encoding a positive regulator of the WNT signaling pathway.
9635432 1998 GBP, an inhibitor of GSK-3, is implicated in Xenopus development and oncogenesis.
More...