Property Summary

NCBI Gene PubMed Count 128
PubMed Score 547.91
PubTator Score 207.11

Knowledge Summary

Patent (44,743)

Expression

  Differential Expression (20)

Disease log2 FC p
Atopic dermatitis -2.900 3.0e-04
colon cancer 2.100 1.1e-02
cutaneous lupus erythematosus -2.100 1.8e-03
cystic fibrosis -2.069 1.6e-05
Duchenne muscular dystrophy -1.002 4.3e-03
group 4 medulloblastoma -1.800 4.0e-03
head and neck cancer -2.000 2.4e-02
intraductal papillary-mucinous neoplasm ... 2.400 1.7e-02
limb girdle muscular dystrophy 2A -1.189 1.5e-03
lung cancer 2.600 1.2e-05
lung carcinoma -1.100 1.7e-05
medulloblastoma, large-cell 1.400 2.3e-04
nasopharyngeal carcinoma 1.800 4.9e-02
ovarian cancer 1.700 3.0e-02
pancreatic cancer 1.500 2.1e-03
Pick disease -1.300 1.4e-02
posterior fossa group A ependymoma 2.100 7.5e-04
primary Sjogren syndrome 1.100 1.5e-02
progressive supranuclear palsy -1.400 4.4e-02
psoriasis -2.200 1.3e-05

Protein-protein Interaction (6)

Gene RIF (121)

AA Sequence

MDTSRLGVLLSLPVLLQLATGGSSPRSGVLLRGCPTHCHCEPDGRMLLRVDCSDLGLSELPSNLSVFTSY      1 - 70
LDLSMNNISQLLPNPLPSLRFLEELRLAGNALTYIPKGAFTGLYSLKVLMLQNNQLRHVPTEALQNLRSL     71 - 140
QSLRLDANHISYVPPSCFSGLHSLRHLWLDDNALTEIPVQAFRSLSALQAMTLALNKIHHIPDYAFGNLS    141 - 210
SLVVLHLHNNRIHSLGKKCFDGLHSLETLDLNYNNLDEFPTAIRTLSNLKELGFHSNNIRSIPEKAFVGN    211 - 280
PSLITIHFYDNPIQFVGRSAFQHLPELRTLTLNGASQITEFPDLTGTANLESLTLTGAQISSLPQTVCNQ    281 - 350
LPNLQVLDLSYNLLEDLPSFSVCQKLQKIDLRHNEIYEIKVDTFQQLLSLRSLNLAWNKIAIIHPNAFST    351 - 420
LPSLIKLDLSSNLLSSFPITGLHGLTHLKLTGNHALQSLISSENFPELKVIEMPYAYQCCAFGVCENAYK    421 - 490
ISNQWNKGDNSSMDDLHKKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDGWLI    491 - 560
RIGVWTIAVLALTCNALVTSTVFRSPLYISPIKLLIGVIAAVNMLTGVSSAVLAGVDAFTFGSFARHGAW    561 - 630
WENGVGCHVIGFLSIFASESSVFLLTLAALERGFSVKYSAKFETKAPFSSLKVIILLCALLALTMAAVPL    631 - 700
LGGSKYGASPLCLPLPFGEPSTMGYMVALILLNSLCFLMMTIAYTKLYCNLDKGDLENIWDCSMVKHIAL    701 - 770
LLFTNCILNCPVAFLSFSSLINLTFISPEVIKFILLVVVPLPACLNPLLYILFNPHFKEDLVSLRKQTYV    771 - 840
WTRSKHPSLMSINSDDVEKQSCDSTQALVTFTSSSITYDLPPSSVPSPAYPVTESCHLSSVAFVPCL       841 - 907
//

Text Mined References (133)

PMID Year Title