Property Summary

NCBI Gene PubMed Count 114
Grant Count 223
R01 Count 97
Funding $19,493,583.92
PubMed Score 477.13
PubTator Score 207.11

Knowledge Summary

Patent (44,743)

Expression

  Differential Expression (20)

Synonym

Accession O75473 D8MCT0 Q4VAM0 Q4VAM2 Q9UP75
Symbols FEX
HG38
GPR49
GPR67
GRP49

Gene

PANTHER Protein Class (1)

PDB

4BSR   4BSS   4BST   4BSU   4KNG   4UFR   4UFS  

  TechDev Info (1)

Steve Finkbeiner Neuron specific phenotypes being screened

Gene RIF (107)

PMID Text
26758198 Lgr5 overexpression was significantly associated with deep invasion of colorectal cancer lymphnode metastasis, distant metastasis and AJCC stage
26674601 This study shows that Lgr5 can be a valuable and reliable prognostic factor of colorectal cancer progression.
26599100 lgr5 methylation, through the regulation of lgr5 expression and colorectal CSC differentiation, may constitute a novel prognostic marker for colorectal cancer patients.
26582901 Report targeting LGR5+ tumor stem cells with an antibody-drug conjugate as effective treatment for colon cancer.
26517508 Data suggest that targeting of leucine rich repeat containing G protein-coupled receptor 5 (LGR5) may be of therapeutic benefit for neuroblastomas.
26416247 We conclude that overexpression of LGR5 is associated with markers of tumor aggressiveness in human papillary thyroid cancer
26397053 The results suggest that trichosanthin may induce apoptosis in glioma cells by targeting LGR5 and repressing the Wnt/betabcatenin signaling pathway
26279446 Lgr5-positive cells may be cancer stem cells-like cells in gastric cancer.
26123262 High resolution crystal structure of an ectodomain variant of human LGR5 (hLGR5ecto) complexed with a signalling competent fragment of mouse Rspo2.
26097379 Demonstrate the presence of LGR5-positive cells in limbal epithelial crypts and their decrease in inflamed conditions, which suggests a critical role of this protein during inflammation and its possible use as a marker in normal crypts.
More...

AA Sequence

MDTSRLGVLLSLPVLLQLATGGSSPRSGVLLRGCPTHCHCEPDGRMLLRVDCSDLGLSELPSNLSVFTSY      1 - 70
LDLSMNNISQLLPNPLPSLRFLEELRLAGNALTYIPKGAFTGLYSLKVLMLQNNQLRHVPTEALQNLRSL     71 - 140
QSLRLDANHISYVPPSCFSGLHSLRHLWLDDNALTEIPVQAFRSLSALQAMTLALNKIHHIPDYAFGNLS    141 - 210
SLVVLHLHNNRIHSLGKKCFDGLHSLETLDLNYNNLDEFPTAIRTLSNLKELGFHSNNIRSIPEKAFVGN    211 - 280
PSLITIHFYDNPIQFVGRSAFQHLPELRTLTLNGASQITEFPDLTGTANLESLTLTGAQISSLPQTVCNQ    281 - 350
LPNLQVLDLSYNLLEDLPSFSVCQKLQKIDLRHNEIYEIKVDTFQQLLSLRSLNLAWNKIAIIHPNAFST    351 - 420
LPSLIKLDLSSNLLSSFPITGLHGLTHLKLTGNHALQSLISSENFPELKVIEMPYAYQCCAFGVCENAYK    421 - 490
ISNQWNKGDNSSMDDLHKKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDGWLI    491 - 560
RIGVWTIAVLALTCNALVTSTVFRSPLYISPIKLLIGVIAAVNMLTGVSSAVLAGVDAFTFGSFARHGAW    561 - 630
WENGVGCHVIGFLSIFASESSVFLLTLAALERGFSVKYSAKFETKAPFSSLKVIILLCALLALTMAAVPL    631 - 700
LGGSKYGASPLCLPLPFGEPSTMGYMVALILLNSLCFLMMTIAYTKLYCNLDKGDLENIWDCSMVKHIAL    701 - 770
LLFTNCILNCPVAFLSFSSLINLTFISPEVIKFILLVVVPLPACLNPLLYILFNPHFKEDLVSLRKQTYV    771 - 840
WTRSKHPSLMSINSDDVEKQSCDSTQALVTFTSSSITYDLPPSSVPSPAYPVTESCHLSSVAFVPCL       841 - 907
//

Text Mined References (119)

PMID Year Title
26758198 2016 Lgr5 expression is a valuable prognostic factor for colorectal cancer: evidence from a meta-analysis.
26674601 2015 Lgr5 expression is a valuable prognostic factor for colorectal cancer: evidence from a meta-analysis.
26599100 2015 Lgr5 Methylation in Cancer Stem Cell Differentiation and Prognosis-Prediction in Colorectal Cancer.
26582901 2015 Targeting LGR5+ cells with an antibody-drug conjugate for the treatment of colon cancer.
26517508 2015 LGR5 regulates pro-survival MEK/ERK and proliferative Wnt/?-catenin signalling in neuroblastoma.
26416247 2015 LGR5 is associated with tumor aggressiveness in papillary thyroid cancer.
26397053 2015 Trichosanthin suppresses the proliferation of glioma cells by inhibiting LGR5 expression and the Wnt/?-catenin signaling pathway.
26279446 2015 Lgr5-Positive Cells are Cancer-Stem-Cell-Like Cells in Gastric Cancer.
26123262 2015 Crystal structure of R-spondin 2 in complex with the ectodomains of its receptors LGR5 and ZNRF3.
26097379 2015 The expression of LGR5 in healthy human stem cell niches and its modulation in inflamed conditions.
More...