Property Summary

NCBI Gene PubMed Count 44
PubMed Score 40.61
PubTator Score 29.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2499 3.011 1.5

Expression

Protein-protein Interaction (9)

Gene RIF (19)

AA Sequence

MSQQRPARKLPSLLLDPTEETVRRRCRDPINVEGLLPSKIRINLEDNVQYVSMRKALKVKRPRFDVSLVY      1 - 70
LTRKFMDLVRSAPGGILDLNKVATKLGVRKRRVYDITNVLDGIDLVEKKSKNHIRWIGSDLSNFGAVPQQ     71 - 140
KKLQEELSDLSAMEDALDELIKDCAQQLFELTDDKENERLAYVTYQDIHSIQAFHEQIVIAVKAPAETRL    141 - 210
DVPAPREDSITVHIRSTNGPIDVYLCEVEQGQTSNKRSEGVGTSSSESTHPEGPEEEENPQQSEELLEVS    211 - 280
N//

Text Mined References (45)

PMID Year Title