Property Summary

NCBI Gene PubMed Count 9
Grant Count 331
R01 Count 128
Funding $62,106,542.45
PubMed Score 24.92
PubTator Score 17.35

Knowledge Summary

Patent

No data available

TINX Plot

Synonym

Accession O75459 Q6FGM3 Q9BSS7 PAGE-1
Symbols AL5
CT16.3
GAGE-9
GAGEB1
PAGE-1

Gene

 GO Process (1)

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGFLRRLIYRRRPMIYVESSEESSDEQPDEVESPTQSQDSTPAEEREDEGASAAQGQEPEADSQELVQPK      1 - 70
TGCELGDGPDTKRVCLRNEEQMKLPAEGPEPEADSQEQVHPKTGCERGDGPDVQELGLPNPEEVKTPEED     71 - 140
EGQSQP                                                                    141 - 146
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18179644 2008 An overview of the GAGE cancer/testis antigen family with the inclusion of newly identified members.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10397259 1999 Characterization of the GAGE genes that are expressed in various human cancers and in normal testis.
More...