Property Summary

NCBI Gene PubMed Count 9
PubMed Score 28.00
PubTator Score 17.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Gene RIF (1)

AA Sequence

MGFLRRLIYRRRPMIYVESSEESSDEQPDEVESPTQSQDSTPAEEREDEGASAAQGQEPEADSQELVQPK      1 - 70
TGCELGDGPDTKRVCLRNEEQMKLPAEGPEPEADSQEQVHPKTGCERGDGPDVQELGLPNPEEVKTPEED     71 - 140
EGQSQP                                                                    141 - 146
//

Text Mined References (13)

PMID Year Title