Property Summary

NCBI Gene PubMed Count 6
PubMed Score 6.90
PubTator Score 8.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 8.4e-11

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 8.4e-11

Gene RIF (3)

AA Sequence

MWLYLAVFVGLYYLLHWYRERQVLSHLRDKYVFITGCDSGFGKLLARQLDARGLRVLAACLTEKGAEQLR      1 - 70
GQTSDRLETVTLDVTKTESVAAAAQWVKECVRDKGLWGLVNNAGISLPTAPNELLTKQDFVTILDVNLLG     71 - 140
VIDVTLSLLPLVRRARGRVVNVSSVMGRVSLFGGGYCISKYGVEAFSDSLRRELSYFGVKVAMIEPGYFK    141 - 210
TAVTSKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLVTNCMEHALIACHPRTR    211 - 280
YSAGWDAKLLYLPMSYMPTFLVDAIMYWVSPSPAKAL                                     281 - 317
//

Text Mined References (8)

PMID Year Title