Property Summary

NCBI Gene PubMed Count 5
PubMed Score 6.06
PubTator Score 8.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.71187084735773E-5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.600 0.000

Synonym

Accession O75452 Q9UNV2
Symbols RODH-4
SDR9C8

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (2)

PMID Text
12534290 Characterization of the retinol dehydrogenase activity of RoDH-4 identifies it as the enzyme capable of accessing the bound form of retinol for retinoic acid production.
11967490 In endometrial cancers, hRoDH-4 immunoreactivity was markedly reduced.

AA Sequence

MWLYLAVFVGLYYLLHWYRERQVLSHLRDKYVFITGCDSGFGKLLARQLDARGLRVLAACLTEKGAEQLR      1 - 70
GQTSDRLETVTLDVTKTESVAAAAQWVKECVRDKGLWGLVNNAGISLPTAPNELLTKQDFVTILDVNLLG     71 - 140
VIDVTLSLLPLVRRARGRVVNVSSVMGRVSLFGGGYCISKYGVEAFSDSLRRELSYFGVKVAMIEPGYFK    141 - 210
TAVTSKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLVTNCMEHALIACHPRTR    211 - 280
YSAGWDAKLLYLPMSYMPTFLVDAIMYWVSPSPAKAL                                     281 - 317
//

Text Mined References (7)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
12534290 2003 Differential recognition of the free versus bound retinol by human microsomal retinol/sterol dehydrogenases: characterization of the holo-CRBP dehydrogenase activity of RoDH-4.
11967490 2002 Expression of a retinol dehydrogenase (hRoDH-4), a member of the retinol/steroid dehydrogenase family implicated in retinoic acid biosynthesis, in normal and neoplastic endometria.
11294878 2001 Characterization of a novel type of human microsomal 3alpha -hydroxysteroid dehydrogenase: unique tissue distribution and catalytic properties.
10329026 1999 Cloning and characterization of retinol dehydrogenase transcripts expressed in human epidermal keratinocytes.
9677409 1998 cDNA cloning and characterization of a new human microsomal NAD+-dependent dehydrogenase that oxidizes all-trans-retinol and 3alpha-hydroxysteroids.