Property Summary

NCBI Gene PubMed Count 27
PubMed Score 13.94
PubTator Score 14.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
active Crohn's disease 1.659 1.9e-03
active ulcerative colitis 1.656 9.1e-03
astrocytoma 1.100 6.4e-15
breast carcinoma 1.100 3.3e-03
ductal carcinoma in situ 1.700 1.2e-03
glioblastoma 1.100 3.2e-05
invasive ductal carcinoma 1.800 2.1e-04
osteosarcoma 1.575 3.6e-04
ovarian cancer -1.100 4.9e-03
Rheumatoid arthritis 1.100 4.4e-02
sonic hedgehog group medulloblastoma 1.100 4.8e-04
tuberculosis 1.500 2.7e-03

Gene RIF (6)

AA Sequence

MNGFTPDEMSRGGDAAAAVAAVVAAAAAAASAGNGTGAGTGAEVPGAGAVSAAGPPGAAGPGPGQLCCLR      1 - 70
EDGERCGRAAGNASFSKRIQKSISQKKVKIELDKSARHLYICDYHKNLIQSVRNRRKRKGSDDDGGDSPV     71 - 140
QDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTLTYFIYSVKNDKNK    141 - 210
SDLKVDSGVH                                                                211 - 220
//

Text Mined References (37)

PMID Year Title