Property Summary

NCBI Gene PubMed Count 27
Grant Count 7
R01 Count 5
Funding $275,018.13
PubMed Score 13.52
PubTator Score 14.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis 1.600 0.012
astrocytoma 1.100 0.000
glioblastoma 2.000 0.000
osteosarcoma 1.575 0.000
tuberculosis 1.500 0.003
active Crohn's disease 1.659 0.002
active ulcerative colitis 1.656 0.009
breast carcinoma 1.200 0.000
sonic hedgehog group medulloblastoma 1.100 0.000
ductal carcinoma in situ 1.700 0.001
invasive ductal carcinoma 1.800 0.000
ovarian cancer -1.100 0.005

Gene RIF (6)

PMID Text
20478393 In the nucleus, SLy2 interacts with the SAP30/HDAC1 complex and regulates the activity of HDAC1.
19015240 findings demonstrate new functions for SAP30L and SAP30 by showing that they can associate directly with core histones as well as naked DNA
17897615 PBF binds to SAP30 and represses transcription via recruitment of the HDAC1 co-repressor complex
17672918 occurrence of an unusual TG 3' splice site in intron 1
15005689 The SAP30 gene may be involved in basal cell carcinogenesis.
12788099 The interaction domains between YY1 and SAP30 were mapped to the C-terminal segment of YY1 (295-414) and the C-terminal 91 amino acid region of SAP30.

AA Sequence

MNGFTPDEMSRGGDAAAAVAAVVAAAAAAASAGNGTGAGTGAEVPGAGAVSAAGPPGAAGPGPGQLCCLR      1 - 70
EDGERCGRAAGNASFSKRIQKSISQKKVKIELDKSARHLYICDYHKNLIQSVRNRRKRKGSDDDGGDSPV     71 - 140
QDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTLTYFIYSVKNDKNK    141 - 210
SDLKVDSGVH                                                                211 - 220
//

Text Mined References (36)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20478393 2010 SLy2 targets the nuclear SAP30/HDAC1 complex.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19223330 2009 Solution structure of a novel zinc finger motif in the SAP30 polypeptide of the Sin3 corepressor complex and its potential role in nucleic acid recognition.
19015240 2009 DNA-binding and -bending activities of SAP30L and SAP30 are mediated by a zinc-dependent module and monophosphoinositides.
More...