Property Summary

NCBI Gene PubMed Count 72
PubMed Score 710.04
PubTator Score 316.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
ovarian cancer 8492 6.81163791457798E-14
psoriasis 6685 4.61876953931519E-8
group 4 medulloblastoma 1875 4.25658993722832E-6
lung adenocarcinoma 2714 1.46842518139012E-5
breast carcinoma 1614 6.8600158613177E-5
primary Sjogren syndrome 789 6.66079104421864E-4
invasive ductal carcinoma 2950 6.79955855780689E-4
ductal carcinoma in situ 1745 0.00127263000417845
cutaneous lupus erythematosus 1056 0.0013596681126836
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00239352866131639
pituitary cancer 1972 0.00397464131134559
hepatocellular carcinoma 550 0.00551272767652583
colon cancer 1475 0.00568359528890639
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00855323418205722
ulcerative colitis 2087 0.009525602852378
Common variable immunodeficiency 98 0.0114272179209772
fibroadenoma 557 0.0137391964924986
astrocytoma 1493 0.015279666122426
esophageal adenocarcinoma 737 0.0176010007179145
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0197800109694577
sarcoidosis 368 0.0228915254082115
Breast cancer 3099 0.0284846274058571
subependymal giant cell astrocytoma 2287 0.0370888933399769
adrenocortical carcinoma 1427 0.044274726567
Disease Target Count Z-score Confidence
Kidney disease 397 0.0 2.0
Disease Target Count Z-score Confidence
Coloboma 52 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2346 4.254 2.1
Cataract 104 0.0 4.0
Intellectual disability 573 0.0 4.0
Disease Target Count Z-score Confidence
Nephrogenic adenofibroma 4 4.231 2.1

Expression

Synonym

Accession O75444 Q66I47 Q9UP93
Symbols CCA4
AYGRP
c-MAF
CTRCT21

Gene

MAF

PANTHER Protein Class (1)

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (50)

PMID Text
26719333 Collectively, these studies show that FGF signaling up-regulates expression of alphaA-crystallin both directly and indirectly via up-regulation of c-Maf.
26694163 Data suggest miR-1290 as the new oncomiR involved in laryngeal squamous cell carcinoma pathogenesis probably through downregulation of its target genes MAF and ITPR2.
26496036 Findings implicate the strong effects of ROS on multiple stem cell functions with a central role for c-Maf in stem cell senescence.
26376684 Results suggest that MAF is a mediator of breast cancer bone metastasis. 16q23 gain or MAF protein overexpression in tumors may help to select patients at risk of bone relapse.
25865493 Disease-causing mutations were demonstrated to impair proper MAF phosphorylation, ubiquitination and proteasomal degradation, perturbed gene expression in primary skin fibroblasts, and induced neurodevelopmental defects in an in vivo model.
25448412 Study added a novel insight for c-MAF ubiquitination and degradation, suggesting that c-MAF stability is strictly regulated.
25064449 Differential effect of cataract-associated mutations in MAF on transactivation of MAF target crystalline genes.
24982420 LPS promotes PDCD4 degradation via a pathway involving PI3K and mTOR, releasing Twist2, which induces IL-10 via c-Maf.
24509877 MAF has a role in mediating crosstalk between Ras-MAPK and mTOR signaling in NF1
23512105 All four of the genes originally identified as showing genome-wide significance (IRF6, ABCA4 and MAF, plus the 8q24 region) were confirmed in this independent sample of trios (who were primarily of European and Southeast Asian ancestry).
More...

AA Sequence

MASELAMSNSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLIAGGSLSSTPMSTPCSSVPPS      1 - 70
PSFSAPSPGSGSEQKAHLEDYYWMTGYPQQLNPEALGFSPEDAVEALISNSHQLQGGFDGYARGAQQLAA     71 - 140
AAGAGAGASLGGSGEEMGPAAAVVSAVIAAAAAQSGAGPHYHHHHHHAAGHHHHPTAGAPGAAGSAAASA    141 - 210
GGAGGAGGGGPASAGGGGGGGGGGGGGGAAGAGGALHPHHAAGGLHFDDRFSDEQLVTMSVRELNRQLRG    211 - 280
VSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEK    281 - 350
LVSSGFRENGSSSDNPSSPEFFM                                                   351 - 373
//

Text Mined References (82)

PMID Year Title
26719333 2016 Regulation of c-Maf and ?A-Crystallin in Ocular Lens by Fibroblast Growth Factor Signaling.
26694163 2015 Global miRNA Expression Profiling Identifies miR-1290 as Novel Potential oncomiR in Laryngeal Carcinoma.
26496036 2015 c-Maf regulates pluripotency genes, proliferation/self-renewal, and lineage commitment in ROS-mediated senescence of human mesenchymal stem cells.
26376684 2015 Enhanced MAF Oncogene Expression and Breast Cancer Bone Metastasis.
25865493 2015 Mutations Impairing GSK3-Mediated MAF Phosphorylation Cause Cataract, Deafness, Intellectual Disability, Seizures, and a Down Syndrome-like Facies.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25448412 2014 Ubiquitination of the transcription factor c-MAF is mediated by multiple lysine residues.
25064449 2014 Differential effect of cataract-associated mutations in MAF on transactivation of MAF target genes.
24982420 2014 LPS induces the degradation of programmed cell death protein 4 (PDCD4) to release Twist2, activating c-Maf transcription to promote interleukin-10 production.
24852370 2014 Genome-wide association study identifies a novel susceptibility gene for serum TSH levels in Chinese populations.
More...