Property Summary

NCBI Gene PubMed Count 81
PubMed Score 758.82
PubTator Score 316.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Kidney disease 430 0.0 3.0
Disease Target Count Z-score Confidence
Coloboma 51 0.0 5.0
Multiple myeloma 1332 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2499 4.303 2.2
Disease Target Count Z-score Confidence
Nephrogenic adenofibroma 4 4.203 2.1

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical carcinoma -1.072 4.4e-02
astrocytoma 1.300 3.6e-02
Breast cancer 3.800 2.8e-02
breast carcinoma -1.400 6.9e-05
colon cancer -1.700 5.7e-03
Common variable immunodeficiency 1.112 1.1e-02
cutaneous lupus erythematosus -1.100 1.4e-03
ductal carcinoma in situ -1.400 1.3e-03
esophageal adenocarcinoma -1.600 1.8e-02
fibroadenoma -1.200 1.4e-02
group 3 medulloblastoma -1.400 5.6e-05
hepatocellular carcinoma 1.100 5.5e-03
intraductal papillary-mucinous adenoma (... -1.100 8.6e-03
intraductal papillary-mucinous carcinoma... -1.100 2.0e-02
invasive ductal carcinoma -1.100 1.1e-02
lung adenocarcinoma -1.078 1.5e-05
non primary Sjogren syndrome sicca 1.200 1.4e-02
ovarian cancer -1.900 9.2e-17
pancreatic ductal adenocarcinoma liver m... -1.209 2.4e-03
pituitary cancer 1.600 4.0e-03
psoriasis -1.100 6.4e-03
sarcoidosis 1.100 2.3e-02
subependymal giant cell astrocytoma 1.449 3.7e-02
ulcerative colitis 1.100 9.5e-03

Gene RIF (59)

AA Sequence

MASELAMSNSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLIAGGSLSSTPMSTPCSSVPPS      1 - 70
PSFSAPSPGSGSEQKAHLEDYYWMTGYPQQLNPEALGFSPEDAVEALISNSHQLQGGFDGYARGAQQLAA     71 - 140
AAGAGAGASLGGSGEEMGPAAAVVSAVIAAAAAQSGAGPHYHHHHHHAAGHHHHPTAGAPGAAGSAAASA    141 - 210
GGAGGAGGGGPASAGGGGGGGGGGGGGGAAGAGGALHPHHAAGGLHFDDRFSDEQLVTMSVRELNRQLRG    211 - 280
VSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEK    281 - 350
LVSSGFRENGSSSDNPSSPEFFM                                                   351 - 373
//

Text Mined References (92)

PMID Year Title