Property Summary

NCBI Gene PubMed Count 15
PubMed Score 62.07
PubTator Score 10.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 8.1e-06
group 4 medulloblastoma 1855 2.5e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
3-methylglutaconic aciduria 29 4.178 2.1

Expression

  Differential Expression (2)

Disease log2 FC p
group 4 medulloblastoma 1.300 2.5e-05
ovarian cancer -1.100 8.1e-06

Protein-protein Interaction (5)

Gene RIF (4)

AA Sequence

MAAAAARVVLSSAARRRLWGFSESLLIRGAAGRSLYFGENRLRSTQAATQVVLNVPETRVTCLESGLRVA      1 - 70
SEDSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLDLELEIENMGAHLNAYTSREQTV     71 - 140
YYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVILREMQEVETNLQEVVFDYLHATAYQNTALGRT    141 - 210
ILGPTENIKSISRKDLVDYITTHYKGPRIVLAAAGGVSHDELLDLAKFHFGDSLCTHKGEIPALPPCKFT    211 - 280
GSEIRVRDDKMPLAHLAIAVEAVGWAHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSF    281 - 350
QSFNTSYTDTGLWGLYMVCESSTVADMLHVVQKEWMRLCTSVTESEVARARNLLKTNMLLQLDGSTPICE    351 - 420
DIGRQMLCYNRRIPIPELEARIDAVNAETIREVCTKYIYNRSPAIAAVGPIKQLPDFKQIRSNMCWLRD     421 - 489
//

Text Mined References (19)

PMID Year Title