Property Summary

NCBI Gene PubMed Count 11
Grant Count 2
Funding $189,446.67
PubMed Score 4.76
PubTator Score 2.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.025
Multiple myeloma 1.519 0.002
malignant mesothelioma -1.100 0.000
astrocytic glioma 1.200 0.032
oligodendroglioma 1.100 0.036
osteosarcoma 1.485 0.000
lung cancer -3.300 0.044

Synonym

Accession O75438 A0AV68
Symbols MNLL
CI-MNLL
CI-SGDH

Gene

 Grant Application (2)

Gene RIF (1)

PMID Text
22190034 HIV-1 gp41 is identified to have a physical interaction with NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1 (NDUFB1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MVNLLQIVRDHWVHVLVPMGFVIGCYLDRKSDERLTAFRNKSMLFKRELQPSEEVTWK                  1 - 58
//

Text Mined References (15)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12611891 2003 The subunit composition of the human NADH dehydrogenase obtained by rapid one-step immunopurification.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...