Property Summary

NCBI Gene PubMed Count 69
PubMed Score 32.99
PubTator Score 29.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Diabetes Mellitus, Type 2 142 0.0 0.0
Disease Target Count P-value
lung adenocarcinoma 2716 2.3e-06
ovarian cancer 8520 3.2e-05
dermatomyositis 966 4.0e-04
Multiple myeloma 1332 6.6e-04
Waldenstrons macroglobulinemia 765 5.8e-03
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 3.0

Expression

  Differential Expression (5)

Disease log2 FC p
dermatomyositis 1.300 4.0e-04
lung adenocarcinoma -1.100 2.3e-06
Multiple myeloma 1.625 6.6e-04
ovarian cancer -1.700 3.2e-05
Waldenstrons macroglobulinemia 1.829 5.8e-03

Protein-protein Interaction (4)

Gene RIF (15)

AA Sequence

MSFLGGFFGPICEIDIVLNDGETRKMAEMKTEDGKVEKHYLFYDGESVSGKVNLAFKQPGKRLEHQGIRI      1 - 70
EFVGQIELFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYESYIGANVRLRYFLKVTIVRRL     71 - 140
TDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEYNKSKYHLKDVIVGKIYFLLVRIKIQHMELQ    141 - 210
LIKKEITGIGPSTTTETETIAKYEIMDGAPVKGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVD    211 - 280
EEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPESQASAEQPEM                           281 - 327
//

Text Mined References (77)

PMID Year Title