Property Summary

NCBI Gene PubMed Count 64
Grant Count 26
R01 Count 6
Funding $1,201,677.55
PubMed Score 30.39
PubTator Score 29.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.829 0.006
Multiple myeloma 1.625 0.001
lung adenocarcinoma -1.100 0.000
ovarian cancer -1.700 0.000
dermatomyositis 1.300 0.000

Gene RIF (15)

PMID Text
25475142 This study demonstrated that Genetic variability of VPS26A in parkinsonism.
25393110 Mutagenesis studies coupled with coimmunoprecipitations revealed that retromer-mediated trafficking requires the Env cytoplasmic tail that we show binds directly to retromer components Vps35 and Vps26.
25393110 The gp41 cytoplasmic tail binds directly to retromer components VPS26 and VPS35 in HIV-1-infected cells
25393110 The gp41 cytoplasmic tail binds directly to retromer components VPS26 and VPS35 in HIV-1-infected cells
25393110 The gp41 cytoplasmic tail binds directly to retromer components VPS26 and VPS35 in HIV-1-infected cells
25393110 The gp41 cytoplasmic tail binds directly to retromer components VPS26 and VPS35 in HIV-1-infected cells
25367362 provides molecular insights into the essential role of Vps26 and Vps35 in Rab7-mediated recruitment of the core retromer complex
25136126 VPS26A binding increases the affinity of the SNX27 PDZ domain for PDZ- binding motifs by an order of magnitude, revealing cooperativity in cargo selection.
24684791 Mutations in the gene composing the retromer cargo recognition subunit are not a common cause of Parkinson's disease.
24417787 Mutations in VPS26A are not a frequent cause of Parkinson's disease.
More...

AA Sequence

MSFLGGFFGPICEIDIVLNDGETRKMAEMKTEDGKVEKHYLFYDGESVSGKVNLAFKQPGKRLEHQGIRI      1 - 70
EFVGQIELFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYESYIGANVRLRYFLKVTIVRRL     71 - 140
TDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEYNKSKYHLKDVIVGKIYFLLVRIKIQHMELQ    141 - 210
LIKKEITGIGPSTTTETETIAKYEIMDGAPVKGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVD    211 - 280
EEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPESQASAEQPEM                           281 - 327
//

Text Mined References (72)

PMID Year Title
27385586 2016 Parkinson Disease-linked Vps35 R524W Mutation Impairs the Endosomal Association of Retromer and Induces ?-Synuclein Aggregation.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26395551 2016 Effect of six type II diabetes susceptibility loci and an FTO variant on obesity in Pakistani subjects.
26220253 2015 Retromer: Structure, function, and roles in mammalian disease.
26199408 2015 The retromer complex in development and disease.
26172538 2015 Retromer Ensures the Degradation of Autophagic Cargo by Maintaining Lysosome Function in Drosophila.
25937119 2015 VPS29-VPS35 intermediate of retromer is stable and may be involved in the retromer complex assembly process.
25475142 2015 Genetic variability of the retromer cargo recognition complex in parkinsonism.
25412306 2014 Characterization of novel markers of senescence and their prognostic potential in cancer.
25393110 2014 Retromer regulates HIV-1 envelope glycoprotein trafficking and incorporation into virions.
More...