Property Summary

NCBI Gene PubMed Count 11
PubMed Score 39.52
PubTator Score 14.55

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.100 5.3e-04
astrocytic glioma -1.700 1.1e-02
lung adenocarcinoma 1.251 3.1e-09
lung cancer 1.700 3.8e-04
Multiple myeloma 1.399 6.4e-04
non-small cell lung cancer 1.018 1.9e-22
oligodendroglioma -1.300 3.7e-02
ovarian cancer 2.200 7.7e-05
Pick disease -1.400 1.3e-04

Gene RIF (4)

AA Sequence

MSLVAEAFVSQIAAAEPWPENATLYQQLKGEQILLSDNAASLAVQAFLQMCNLPIKVVCRANAEYMSPSG      1 - 70
KVPFIHVGNQVVSELGPIVQFVKAKGHSLSDGLEEVQKAEMKAYMELVNNMLLTAELYLQWCDEATVGEI     71 - 140
THARYGSPYPWPLNHILAYQKQWEVKRKMKAIGWGKKTLDQVLEDVDQCCQALSQRLGTQPYFFNKQPTE    141 - 210
LDALVFGHLYTILTTQLTNDELSEKVKNYSNLLAFCRRIEQHYFEDRGKGRLS                     211 - 263
//

Text Mined References (15)

PMID Year Title