Property Summary

NCBI Gene PubMed Count 5
PubMed Score 13.61
PubTator Score 7.77

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
15533722 Deletion fo the Mospd3 locus is mutagenic and breeding to homozygosity results in a characteristic right ventricle defect and neonatal lethality in 50% of mice.

AA Sequence

MRRGAPQDQELVGPGPPGRGSRGAPPPLGPVVPVLVFPPDLVFRADQRSGPRQLLTLYNPTGTALRFRVL      1 - 70
CTAPAKYTVFDAEGYVKPQSCIDIVIRHVAPIPSHYDVQDRFRIELSEEGAEGRVVGRKDITSILRAPAY     71 - 140
PLELQGQPDPAPRPGPPAGTPPPTARHFQEHPRQQLATSSFLLFLLTGIVSVAFLLLPLPDELGSQLPQV    141 - 210
LHVSLGQKLVAAYVLGLLTMVFLRT                                                 211 - 235
//

Text Mined References (6)

PMID Year Title
15533722 2004 A novel transmembrane MSP-containing protein that plays a role in right ventricle development.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9799793 1998 Large-scale sequencing of two regions in human chromosome 7q22: analysis of 650 kb of genomic sequence around the EPO and CUTL1 loci reveals 17 genes.