Property Summary

NCBI Gene PubMed Count 42
Grant Count 99
R01 Count 63
Funding $8,003,329.05
PubMed Score 105.83
PubTator Score 63.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma 3.100 0.000
osteosarcoma -1.642 0.003
glioblastoma 1.800 0.000
group 3 medulloblastoma 2.600 0.000
atypical teratoid / rhabdoid tumor 1.700 0.000
medulloblastoma, large-cell 2.700 0.000
primitive neuroectodermal tumor 2.000 0.000
adrenocortical carcinoma 1.054 0.008
non-small cell lung cancer 2.635 0.000
lung cancer 1.100 0.005
lung adenocarcinoma 1.300 0.000
adult high grade glioma 1.400 0.001
psoriasis 1.700 0.000
Breast cancer 1.600 0.000
ductal carcinoma in situ 1.200 0.005
invasive ductal carcinoma 1.600 0.000
ovarian cancer 1.600 0.000

Synonym

Accession O75419 B4DDB4 B4DDU3 E9PDH7 O60856 Q20WK8 Q6UW54 Q9UP68
Symbols CDC45L
MGORS7
CDC45L2
PORC-PI-1

Gene

PDB

5DGO  

Gene RIF (22)

PMID Text
25933514 The depletion of HDHB from human cells diminishes Cdc45 association with chromatin, suggesting that HDHB may facilitate Cdc45 recruitment at G1/S in human cells.
24293646 The findings suggest that hCdc45 not only binds to but also slides on DNA with a 3'-5' polarity and, thereby acts as a molecular 'wedge' to initiate DNA strand displacement.
23750504 Data suggest that CDC45 and MCM10 (minichromosome maintenance complex component 10) directly interact and establish a mutual co-operation in DNA binding; key domains appear to interact and then interact with DNA inside cells or in cell-free systems.
23364835 CDC45 directly interact with MCM2-7 proteins; with PSF2, PSF3 and SLD5 in GINS subunits; and with replication protein A2, AND-1. A considerable portion of CDC45 localizes in a region other than the DNA replication forks in nuclei.
22536402 After UV-damage, Cdc45 is still present in a large multi-protein complex and that its mobility within living cells is consistently similar following UVC-mediated DNA damage.
22474384 Data show that using a 200-nt primed circular DNA substrate, the combined action of DNA polymerase epsilon and the Cdc45/Mcm2-7/GINS (CMG complex) leads to the formation of products >10 kb in length.
22147708 Structural and functional insights into the DNA replication factor Cdc45 reveal an evolutionary relationship to the DHH family of phosphoesterases
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20124417 Cdc45, which is known to be required for replication fork progression, shows similar patterns of origin association to those of Timeless
20065034 The coordinated binding of DUE-B and Cdc45 to origins and the physical interactions of DUE-B, Cdc45, and TopBP1 suggest that complexes of these proteins are necessary for replication initiation.
More...

AA Sequence

MFVSDFRKEFYEVVQSQRVLLFVASDVDALCACKILQALFQCDHVQYTLVPVSGWQELETAFLEHKEQFH      1 - 70
YFILINCGANVDLLDILQPDEDTIFFVCDTHRPVNVVNVYNDTQIKLLIKQDDDLEVPAYEDIFRDEEED     71 - 140
EEHSGNDSDGSEPSEKRTRLEEEIVEQTMRRRQRREWEARRRDILFDYEQYEYHGTSSAMVMFELAWMLS    141 - 210
KDLNDMLWWAIVGLTDQWVQDKITQMKYVTDVGVLQRHVSRHNHRNEDEENTLSVDCTRISFEYDLRLVL    211 - 280
YQHWSLHDSLCNTSYTAARFKLWSVHGQKRLQEFLADMGLPLKQVKQKFQAMDISLKENLREMIEESANK    281 - 350
FGMKDMRVQTFSIHFGFKHKFLASDVVFATMSLMESPEKDGSGTDHFIQALDSLSRSNLDKLYHGLELAK    351 - 420
KQLRATQQTIASCLCTNLVISQGPFLYCSLMEGTPDVMLFSRPASLSLLSKHLLKSFVCSTKNRRCKLLP    421 - 490
LVMAAPLSMEHGTVTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRMLHNHFDLSVIELKAEDRSKFLDA    491 - 560
LISLLS                                                                    561 - 566
//

Text Mined References (48)

PMID Year Title
25933514 2015 Human DNA helicase B interacts with the replication initiation protein Cdc45 and facilitates Cdc45 binding onto chromatin.
25416956 2014 A proteome-scale map of the human interactome network.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24293646 2014 DNA binding properties of human Cdc45 suggest a function as molecular wedge for DNA unwinding.
23910567 2013 Cell cycle-dependent formation of Cdc45-Claspin complexes in human cells is compromized by UV-mediated DNA damage.
23750504 2013 The physical interaction of Mcm10 with Cdc45 modulates their DNA-binding properties.
23364835 2013 Protein interaction and cellular localization of human CDC45.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22536402 2012 Cell cycle-dependent mobility of Cdc45 determined in vivo by fluorescence correlation spectroscopy.
22474384 2012 Properties of the human Cdc45/Mcm2-7/GINS helicase complex and its action with DNA polymerase epsilon in rolling circle DNA synthesis.
More...