Property Summary

NCBI Gene PubMed Count 35
PubMed Score 17.99
PubTator Score 18.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung adenocarcinoma 2714 2.51685096181647E-22
lung carcinoma 2844 1.43541157347123E-17
non-small cell lung cancer 2798 2.09345697521329E-14
ovarian cancer 8492 2.56619311046599E-9
medulloblastoma 1524 3.52499385423349E-7
psoriasis 6685 7.53989400899824E-7
medulloblastoma, large-cell 6234 8.26305531220691E-7
atypical teratoid / rhabdoid tumor 4369 1.24446944402614E-6
Pick disease 1893 1.51238481988798E-6
Rheumatoid Arthritis 1171 6.85356661715209E-6
osteosarcoma 7933 1.12466733257687E-5
tuberculosis and treatment for 6 months 686 1.73548587607644E-5
ependymoma 2514 2.00583584178626E-5
Duchenne muscular dystrophy 602 2.2372906084245E-5
lung cancer 4473 4.01802620144015E-5
breast carcinoma 1614 5.54642704042508E-5
invasive ductal carcinoma 2950 4.10624229258909E-4
ductal carcinoma in situ 1745 4.19801839691607E-4
adult high grade glioma 2148 0.00172726803398486
primitive neuroectodermal tumor 3031 0.0028987866608329
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00387791558491295
colon cancer 1475 0.00546191238493615
dermatomyositis 967 0.00561917214934454
Multiple myeloma 1328 0.00602780416537471
glioblastoma 5572 0.0117326039105791
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0242580092837363
fibroadenoma 557 0.0277417999089758
Disease Target Count
Giant Cell Glioblastoma 12
gliosarcoma 19

Expression

  Differential Expression (27)

Disease log2 FC p
Rheumatoid Arthritis 2.400 0.000
Multiple myeloma 1.213 0.006
psoriasis -1.500 0.000
osteosarcoma -2.144 0.000
ependymoma -1.400 0.000
glioblastoma -1.400 0.012
medulloblastoma -2.700 0.000
atypical teratoid / rhabdoid tumor -2.700 0.000
medulloblastoma, large-cell -3.500 0.000
primitive neuroectodermal tumor -1.600 0.003
Duchenne muscular dystrophy 1.160 0.000
autosomal dominant Emery-Dreifuss muscul... 1.050 0.024
tuberculosis and treatment for 6 months 1.200 0.000
non-small cell lung cancer -1.340 0.000
intraductal papillary-mucinous adenoma (... -1.600 0.004
lung cancer -3.600 0.000
colon cancer -1.100 0.005
breast carcinoma -1.500 0.000
fibroadenoma -1.300 0.028
lung adenocarcinoma -2.000 0.000
adult high grade glioma -1.800 0.002
lung carcinoma -1.100 0.000
Pick disease 1.500 0.000
ductal carcinoma in situ -1.800 0.000
invasive ductal carcinoma -2.100 0.000
ovarian cancer -3.600 0.000
dermatomyositis 1.300 0.006

Gene

  Ortholog (9)

Gene RIF (15)

PMID Text
25297519 The correlation between TACC1 expression and HER-2-positive status indicates synergistic regulation of these two prognostic markers in gastric carcinoma patients.
24358147 TFF3 and TACC1 over-expression in epithelial cells of surgically resected gastric cancer tissues was an independent predictor of short survival in gastric cancer patients.
23354013 These findings provide proof and the foundation for the molecular and biological relationships of ErbB-2 and TACC1 in breast cancer.
22837387 study reports that a small subset of glioblastoma multiforme tumors harbors oncogenic chromosomal translocations that fuse in-frame the tyrosine kinase coding domains of fibroblast growth factor receptor genes(FGFR1 or FGFR3) to the transforming acidic coiled-coil coding domains of TACC1 or TACC3; the FGFR-TACC fusion protein displays oncogenic activity
21531210 the study demonstrated that TACC1 localizes at the midbody during cytokinesis and interacts with and is a substrate of Aurora-C, which warrant further investigation in order to elucidate the functional significance of this interaction.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20508983 Observational study of gene-disease association. (HuGE Navigator)
20078863 TACC1 depletion in the cell led to decreased RARalpha and TRalpha ligand-dependent transcriptional activity and to delocalization of TR from the nucleus to the cytoplasm.
18984771 TACC1 and a three-gene expression signature (TACC1, NOV, and PTTG1) were identified as independent prognostic markers.
16496324 Splice variants can be localized to different subcellular compartments in a cell-and tissue-specific manner.
More...

AA Sequence

MAFSPWQILSPVQWAKWTWSAVRGGAAGEDEAGGPEGDPEEEDSQAETKSLSFSSDSEGNFETPEAETPI      1 - 70
RSPFKESCDPSLGLAGPGAKSQESQEADEQLVAEVVEKCSSKTCSKPSENEVPQQAIDSHSVKNFREEPE     71 - 140
HDFSKISIVRPFSIETKDSTDISAVLGTKAAHGCVTAVSGKALPSSPPDALQDEAMTEGSMGVTLEASAE    141 - 210
ADLKAGNSCPELVPSRRSKLRKPKPVPLRKKAIGGEFSDTNAAVEGTPLPKASYHFSPEELDENTSPLLG    211 - 280
DARFQKSPPDLKETPGTLSSDTNDSGVELGEESRSSPLKLEFDFTEDTGNIEARKALPRKLGRKLGSTLT    281 - 350
PKIQKDGISKSAGLEQPTDPVARDGPLSQTSSKPDPSQWESPSFNPFGSHSVLQNSPPLSSEGSYHFDPD    351 - 420
NFDESMDPFKPTTTLTSSDFCSPTGNHVNEILESPKKAKSRLITSGCKVKKHETQSLALDACSRDEGAVI    421 - 490
SQISDISNRDGHATDEEKLASTSCGQKSAGAEVKGEPEEDLEYFECSNVPVSTINHAFSSSEAGIEKETC    491 - 560
QKMEEDGSTVLGLLESSAEKAPVSVSCGGESPLDGICLSESDKTAVLTLIREEIITKEIEANEWKKKYEE    561 - 630
TRQEVLEMRKIVAEYEKTIAQMIEDEQRTSMTSQKSFQQLTMEKEQALADLNSVERSLSDLFRRYENLKG    631 - 700
VLEGFKKNEEALKKCAQDYLARVKQEEQRYQALKIHAEEKLDKANEEIAQVRTKAKAESAALHAGLRKEQ    701 - 770
MKVESLERALQQKNQEIEELTKICDELIAKLGKTD                                       771 - 805
//

Text Mined References (43)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25807930 2015 Multifunctional reagents for quantitative proteome-wide analysis of protein modification in human cells and dynamic profiling of protein lipidation during vertebrate development.
25416956 2014 A proteome-scale map of the human interactome network.
25297519 2014 Prognosis significance of HER2 status and TACC1 expression in patients with gastric carcinoma.
24358147 2013 Impact of NPM, TFF3 and TACC1 on the prognosis of patients with primary gastric cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23354013 2013 Efficient downregulation of ErbB-2 induces TACC1 upregulation in breast cancer cell lines.
23275563 2013 Development and application of a DNA microarray-based yeast two-hybrid system.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22837387 2012 Transforming fusions of FGFR and TACC genes in human glioblastoma.
More...