Property Summary

NCBI Gene PubMed Count 35
PubMed Score 18.81
PubTator Score 18.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
adult high grade glioma -1.800 1.7e-03
atypical teratoid / rhabdoid tumor -2.700 1.2e-06
autosomal dominant Emery-Dreifuss muscul... 1.050 2.4e-02
breast carcinoma -1.400 1.9e-03
colon cancer -1.100 5.5e-03
dermatomyositis 1.300 5.6e-03
Duchenne muscular dystrophy 1.160 2.2e-05
ductal carcinoma in situ -1.800 4.2e-04
ependymoma -1.400 2.0e-05
fibroadenoma -1.300 2.8e-02
glioblastoma -1.200 3.8e-03
group 3 medulloblastoma -1.800 1.0e-02
intraductal papillary-mucinous adenoma (... -1.300 2.4e-02
invasive ductal carcinoma -2.100 4.1e-04
lung adenocarcinoma -1.100 2.5e-12
lung cancer -2.600 1.4e-04
lung carcinoma -1.100 1.4e-17
medulloblastoma, large-cell -3.500 8.3e-07
Multiple myeloma 1.213 6.0e-03
non-small cell lung cancer -1.191 2.3e-08
osteosarcoma -1.422 1.3e-02
ovarian cancer -2.200 5.7e-12
Pick disease 1.500 1.5e-06
primitive neuroectodermal tumor -1.600 2.9e-03
psoriasis -1.500 7.5e-07
Rheumatoid arthritis 2.400 6.9e-06
tuberculosis and treatment for 6 months 1.200 1.7e-05

Gene RIF (15)

AA Sequence

MAFSPWQILSPVQWAKWTWSAVRGGAAGEDEAGGPEGDPEEEDSQAETKSLSFSSDSEGNFETPEAETPI      1 - 70
RSPFKESCDPSLGLAGPGAKSQESQEADEQLVAEVVEKCSSKTCSKPSENEVPQQAIDSHSVKNFREEPE     71 - 140
HDFSKISIVRPFSIETKDSTDISAVLGTKAAHGCVTAVSGKALPSSPPDALQDEAMTEGSMGVTLEASAE    141 - 210
ADLKAGNSCPELVPSRRSKLRKPKPVPLRKKAIGGEFSDTNAAVEGTPLPKASYHFSPEELDENTSPLLG    211 - 280
DARFQKSPPDLKETPGTLSSDTNDSGVELGEESRSSPLKLEFDFTEDTGNIEARKALPRKLGRKLGSTLT    281 - 350
PKIQKDGISKSAGLEQPTDPVARDGPLSQTSSKPDPSQWESPSFNPFGSHSVLQNSPPLSSEGSYHFDPD    351 - 420
NFDESMDPFKPTTTLTSSDFCSPTGNHVNEILESPKKAKSRLITSGCKVKKHETQSLALDACSRDEGAVI    421 - 490
SQISDISNRDGHATDEEKLASTSCGQKSAGAEVKGEPEEDLEYFECSNVPVSTINHAFSSSEAGIEKETC    491 - 560
QKMEEDGSTVLGLLESSAEKAPVSVSCGGESPLDGICLSESDKTAVLTLIREEIITKEIEANEWKKKYEE    561 - 630
TRQEVLEMRKIVAEYEKTIAQMIEDEQRTSMTSQKSFQQLTMEKEQALADLNSVERSLSDLFRRYENLKG    631 - 700
VLEGFKKNEEALKKCAQDYLARVKQEEQRYQALKIHAEEKLDKANEEIAQVRTKAKAESAALHAGLRKEQ    701 - 770
MKVESLERALQQKNQEIEELTKICDELIAKLGKTD                                       771 - 805
//

Text Mined References (43)

PMID Year Title