Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Acquired immunodeficiency syndrome 197 3.013 1.5

Synonym

Accession O75409 A1A4D3
Symbols HIP17
CXorf27

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MSEKKNCKNSSTNNNQTQDPSRNELQVPRSFVDRVVQDERDVQSQSSSTINTLLTLLDCLADYIMERVGL      1 - 70
EASNNGSMRNTSQDREREVDNNREPHSAESDVTRFLFDEMPKSRKND                            71 - 117
//

Text Mined References (5)

PMID Year Title