Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.70

Knowledge Summary

Patent

No data available

Synonym

Accession O75409 A1A4D3
Symbols HIP17
CXorf27

Gene

AA Sequence

MSEKKNCKNSSTNNNQTQDPSRNELQVPRSFVDRVVQDERDVQSQSSSTINTLLTLLDCLADYIMERVGL      1 - 70
EASNNGSMRNTSQDREREVDNNREPHSAESDVTRFLFDEMPKSRKND                            71 - 117
//

Text Mined References (5)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9700202 1998 Huntingtin interacts with a family of WW domain proteins.