Property Summary

NCBI Gene PubMed Count 33
PubMed Score 79.98
PubTator Score 44.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma 1.200 9.4e-04
Amyotrophic lateral sclerosis 1.006 1.0e-05
atypical teratoid / rhabdoid tumor 1.700 3.1e-07
Breast cancer 2.500 2.7e-02
dermatomyositis 1.800 2.0e-04
esophageal adenocarcinoma 1.400 3.7e-02
glioblastoma 1.200 2.1e-07
group 3 medulloblastoma 1.200 1.5e-02
intraductal papillary-mucinous carcinoma... 1.200 1.1e-02
juvenile dermatomyositis 1.145 1.2e-09
lung cancer 1.200 6.5e-04
medulloblastoma, large-cell 1.900 1.4e-05
Multiple myeloma 1.490 5.2e-04
osteosarcoma 1.999 8.9e-07
ovarian cancer 2.000 5.8e-06
pancreatic ductal adenocarcinoma liver m... 1.438 4.0e-02
Pick disease 1.200 9.4e-06
primitive neuroectodermal tumor 1.900 1.0e-06
psoriasis 1.400 2.3e-03
Rheumatoid arthritis 1.200 4.3e-03
Waldenstrons macroglobulinemia 1.557 2.8e-02

Gene RIF (10)

AA Sequence

MRPGTGAERGGLMVSEMESHPPSQGPGDGERRLSGSSLCSGSWVSADGFLRRRPSMGHPGMHYAPMGMHP      1 - 70
MGQRANMPPVPHGMMPQMMPPMGGPPMGQMPGMMSSVMPGMMMSHMSQASMQPALPPGVNSMDVAAGTAS     71 - 140
GAKSMWTEHKSPDGRTYYYNTETKQSTWEKPDDLKTPAEQLLSKCPWKEYKSDSGKPYYYNSQTKESRWA    141 - 210
KPKELEDLEGYQNTIVAGSLITKSNLHAMIKAEESSKQEECTTTSTAPVPTTEIPTTMSTMAAAEAAAAV    211 - 280
VAAAAAAAAAAAAANANASTSASNTVSGTVPVVPEPEVTSIVATVVDNENTVTISTEEQAQLTSTPAIQD    281 - 350
QSVEVSSNTGEETSKQETVADFTPKKEEEESQPAKKTYTWNTKEEAKQAFKELLKEKRVPSNASWEQAMK    351 - 420
MIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEAKESFQRFLENHEKMTSTTRYKKAEQMF    421 - 490
GEMEVWNAISERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYSTTWSEAQQYLMDN    491 - 560
PTFAEDEELQNMDKEDALICFEEHIRALEKEEEEEKQKSLLRERRRQRKNRESFQIFLDELHEHGQLHSM    561 - 630
SSWMELYPTISSDIRFTNMLGQPGSTALDLFKFYVEDLKARYHDEKKIIKDILKDKGFVVEVNTTFEDFV    631 - 700
AIISSTKRSTTLDAGNIKLAFNSLLEKAEAREREREKEEARKMKRKESAFKSMLKQAAPPIELDAVWEDI    701 - 770
RERFVKEPAFEDITLESERKRIFKDFMHVLEHECQHHHSKNKKHSKKSKKHHRKRSRSRSGSDSDDDDSH    771 - 840
SKKKRQRSESRSASEHSSSAESERSYKKSKKHKKKSKKRRHKSDSPESDAEREKDKKEKDRESEKDRTRQ    841 - 910
RSESKHKSPKKKTGKDSGNWDTSGSELSEGELEKRRRTLLEQLDDDQ                           911 - 957
//

Text Mined References (45)

PMID Year Title