Property Summary

NCBI Gene PubMed Count 30
PubMed Score 51.89
PubTator Score 198.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Epilepsy 792 0.0 4.0
Disease Target Count Z-score Confidence
Smith-Magenis syndrome 29 3.854 1.9
Panic disorder 61 3.33 1.7

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -2.000 1.9e-06
astrocytoma -2.300 1.6e-03
Astrocytoma, Pilocytic -1.100 5.5e-05
atypical teratoid / rhabdoid tumor -1.900 1.1e-09
glioblastoma -1.500 8.9e-07
group 4 medulloblastoma -1.300 4.1e-04
inflammatory breast cancer -1.200 7.8e-05
medulloblastoma, large-cell -1.500 1.5e-05
subependymal giant cell astrocytoma -1.861 1.2e-03

Gene RIF (20)

AA Sequence

MEDSDSAAKQLGLAEAAAVAAAAAVAAAAAAAAGGEAEEPVLSRDEDSEEDADSEAERETPRVTAVAVMA      1 - 70
AEPGHMDMGAEALPGPDEAAAAAAFAEVTTVTVANVGAAADNVFTTSVANAASISGHVLSGRTALQIGDS     71 - 140
LNTEKATLIVVHTDGSIVETTGLKGPAAPLTPGPQSPPTPLAPGQEKGGTKYNWDPSVYDSELPVRCRNI    141 - 210
SGTLYKNRLGSGGRGRCIKQGENWYSPTEFEAMAGRASSKDWKRSIRYAGRPLQCLIQDGILNPHAASCT    211 - 280
CAACCDDMTLSGPVRLFVPYKRRKKENELPTTPVKKDSPKNITLLPATAATTFTVTPSGQITTSGALTFD    281 - 350
RASTVEATAVISESPAQGDVFAGATVQEASVQPPCRASHPEPHYPGYQDSCQIAPFPEAALPTSHPKIVL    351 - 420
TSLPALAVPPPTPTKAAPPALVNGLELSEPRSWLYLEEMVNSLLNTAQQLKTLFEQAKHASTYREAATNQ    421 - 490
AKIHADAERKEQSCVNCGREAMSECTGCHKVNYCSTFCQRKDWKDHQHICGQSAAVTVQADEVHVAESVM    491 - 560
EKVTV                                                                     561 - 565
//

Text Mined References (36)

PMID Year Title