Property Summary

NCBI Gene PubMed Count 24
PubMed Score 0.00
PubTator Score 9.10

Knowledge Summary

Patent

No data available

Synonym

Accession O75396 A8K1G0
Symbols ERS-24
SEC22L1

Gene

PDB

3EGX   2NUP   2NUT   3EGD  

Gene RIF (3)

PMID Text
26082458 the target gene SEC22B regulated by miRNA-206 may play a key role in the progression and development of AD.
24705552 Suggest that close apposition of the ER and plasma membrane mediated by Sec22b and plasma membrane syntaxins generates a non-fusogenic SNARE bridge contributing to plasma membrane expansion, probably through non-vesicular lipid transfer.
22264512 DrrA activation of the Rab1 GTPase on plasma membrane-derived organelles stimulated the tethering of endoplasmic reticulum-derived vesicles, resulting in vesicle fusion through the pairing of Sec22b with the plasma membrane syntaxin proteins.

AA Sequence

MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVC      1 - 70
DLVLCEAAFPKTLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSCARRNLGSINT     71 - 140
ELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKYRQDAKYLNMHSTYAKLAAVAVFFIMLIVYV    141 - 210
RFWWL                                                                     211 - 215
//

Text Mined References (35)

PMID Year Title
26082458 2016 Identification of Biomarkers Associated With Alzheimer's Disease by Bioinformatics Analysis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24705552 2014 The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22264512 2012 The Legionella pneumophila effector DrrA is sufficient to stimulate SNARE-dependent membrane fusion.
22153078 2011 Sec22b regulates phagosomal maturation and antigen crosspresentation by dendritic cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...