Property Summary

NCBI Gene PubMed Count 9
PubMed Score 10.79
PubTator Score 7.12

Knowledge Summary

Patent (1,768)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 0.5
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Secondary progressive multiple sclerosis 10 4.623 2.3

Gene RIF (5)

AA Sequence

MNGVSEGTRGCSDRQPGVLTRDRSCSRKMNSSGCLSEEVGSLRPLTVVILSASIVVGVLGNGLVLWMTVF      1 - 70
RMARTVSTVCFFHLALADFMLSLSLPIAMYYIVSRQWLLGEWACKLYITFVFLSYFASNCLLVFISVDRC     71 - 140
ISVLYPVWALNHRTVQRASWLAFGVWLLAAALCSAHLKFRTTRKWNGCTHCYLAFNSDNETAQIWIEGVV    141 - 210
EGHIIGTIGHFLLGFLGPLAIIGTCAHLIRAKLLREGWVHANRPKRLLLVLVSAFFIFWSPFNVVLLVHL    211 - 280
WRRVMLKEIYHPRMLLILQASFALGCVNSSLNPFLYVFVGRDFQEKFFQSLTSALARAFGEEEFLSSCPR    281 - 350
GNAPRE                                                                    351 - 356
//

Text Mined References (9)

PMID Year Title