Property Summary

NCBI Gene PubMed Count 9
Grant Count 1
Funding $19,000
PubMed Score 9.31
PubTator Score 7.12

Knowledge Summary

Patent (1,768)

TINX Plot

  Disease Relevance (1)

Synonym

Accession O75388 Q502U7 Q6NWS5
Symbols RVDR1

Gene

PANTHER Protein Class (2)

 Grant Application (1)

  TechDev Info (1)

Gene RIF (5)

PMID Text
26339162 Our findings indicate that chitotriosidase and S10012A are useful in diagnosis and detection of subclinical inflammation and/or assessment of disease activity in FMF patients.
25320283 Resolvin D1 attenuates the viral mimic-induced inflammatory signaling in human airway epithelial cells via TAK1.
25030943 The effects of diclofenac on the incidence of pancreatitis following endoscopic retrograde cholangiopancreatography via lipoxin A4 and resolvin D1 and E1 levels is reported.
24120851 Results suggest that resolvin D1 inhibited TGF-beta1-induced EMT via ALX/FPR2 and GPR32 by reducing the expression of ZEB1.
20080636 results indicate that RvD1 specifically interacts with both ALX and GPR32 on phagocytes.

AA Sequence

MNGVSEGTRGCSDRQPGVLTRDRSCSRKMNSSGCLSEEVGSLRPLTVVILSASIVVGVLGNGLVLWMTVF      1 - 70
RMARTVSTVCFFHLALADFMLSLSLPIAMYYIVSRQWLLGEWACKLYITFVFLSYFASNCLLVFISVDRC     71 - 140
ISVLYPVWALNHRTVQRASWLAFGVWLLAAALCSAHLKFRTTRKWNGCTHCYLAFNSDNETAQIWIEGVV    141 - 210
EGHIIGTIGHFLLGFLGPLAIIGTCAHLIRAKLLREGWVHANRPKRLLLVLVSAFFIFWSPFNVVLLVHL    211 - 280
WRRVMLKEIYHPRMLLILQASFALGCVNSSLNPFLYVFVGRDFQEKFFQSLTSALARAFGEEEFLSSCPR    281 - 350
GNAPRE                                                                    351 - 356
//

Text Mined References (9)

PMID Year Title
26339162 2015 S1000A12, Chitotriosidase, and Resolvin D1 as Potential Biomarkers of Familial Mediterranean Fever.
25320283 2014 Resolvin D1 attenuates polyinosinic-polycytidylic acid-induced inflammatory signaling in human airway epithelial cells via TAK1.
25030943 2014 Effect of diclofenac on the levels of lipoxin A4 and Resolvin D1 and E1 in the post-ERCP pancreatitis.
24120851 2013 Resolvin D1 inhibits TGF-?1-induced epithelial mesenchymal transition of A549 lung cancer cells via lipoxin A4 receptor/formyl peptide receptor 2 and GPR32.
22542696 2012 Omega-3 fatty acids in anti-inflammation (pro-resolution) and GPCRs.
20080636 2010 Resolvin D1 binds human phagocytes with evidence for proresolving receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9653656 1998 Cloning genes encoding receptors related to chemoattractant receptors.