Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.80
PubTator Score 7.70

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
12930836 LAT3 is a transporter subserving system L2 and should denote a new family of organic solute transporters

AA Sequence

MAPTLQQAYRRRWWMACTAVLENLFFSAVLLGWGSLLIILKNEGFYSSTCPAESSTNTTQDEQRRWPGCD      1 - 70
QQDEMLNLGFTIGSFVLSATTLPLGILMDRFGPRPVRLVGSACFTASCTLMALASRDVEALSPLIFLALS     71 - 140
LNGFGGICLTFTSLTLPNMFGNLRSTLMALMIGSYASSAITFPGIKLIYDAGVAFVVIMFTWSGLACLIF    141 - 210
LNCTLNWPIEAFPAPEEVNYTKKIKLSGLALDHKVTGDLFYTHVTTMGQRLSQKAPSLEDGSDAFMSPQD    211 - 280
VRGTSENLPERSVPLRKSLCSPTFLWSLLTMGMTQLRIIFYMAAVNKMLEYLVTGGQEHETNEQQQKVAE    281 - 350
TVGFYSSVFGAMQLLCLLTCPLIGYIMDWRIKDCVDAPTQGTVLGDARDGVATKSIRPRYCKIQKLTNAI    351 - 420
SAFTLTNLLLVGFGITCLINNLHLQFVTFVLHTIVRGFFHSACGSLYAAVFPSNHFGTLTGLQSLISAVF    421 - 490
ALLQQPLFMAMVGPLKGEPFWVNLGLLLFSLLGFLLPSYLFYYRARLQQEYAANGMGPLKVLSGSEVTA     491 - 559
//

Text Mined References (12)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18195088 2008 Amino acid transport across mammalian intestinal and renal epithelia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12930836 2003 Identification of a novel system L amino acid transporter structurally distinct from heterodimeric amino acid transporters.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11956097 2002 New insights into testicular germ cell tumorigenesis from gene expression profiling.
9722952 1998 cDNA sequencing and analysis of POV1 (PB39): a novel gene up-regulated in prostate cancer.
9255310 1997 Identification of a novel transcript up-regulated in a clinically aggressive prostate carcinoma.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
972295 1976 Encephalomalacia unrelated to vascular occlusion.