Property Summary

NCBI Gene PubMed Count 10
Grant Count 5
Funding $169,637.9
PubMed Score 10.80
PubTator Score 7.70

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O75387
Symbols LAT3
PB39
POV1
R00504

Gene

PANTHER Protein Class (2)

Gene RIF (1)

PMID Text
12930836 LAT3 is a transporter subserving system L2 and should denote a new family of organic solute transporters

AA Sequence

MAPTLQQAYRRRWWMACTAVLENLFFSAVLLGWGSLLIILKNEGFYSSTCPAESSTNTTQDEQRRWPGCD      1 - 70
QQDEMLNLGFTIGSFVLSATTLPLGILMDRFGPRPVRLVGSACFTASCTLMALASRDVEALSPLIFLALS     71 - 140
LNGFGGICLTFTSLTLPNMFGNLRSTLMALMIGSYASSAITFPGIKLIYDAGVAFVVIMFTWSGLACLIF    141 - 210
LNCTLNWPIEAFPAPEEVNYTKKIKLSGLALDHKVTGDLFYTHVTTMGQRLSQKAPSLEDGSDAFMSPQD    211 - 280
VRGTSENLPERSVPLRKSLCSPTFLWSLLTMGMTQLRIIFYMAAVNKMLEYLVTGGQEHETNEQQQKVAE    281 - 350
TVGFYSSVFGAMQLLCLLTCPLIGYIMDWRIKDCVDAPTQGTVLGDARDGVATKSIRPRYCKIQKLTNAI    351 - 420
SAFTLTNLLLVGFGITCLINNLHLQFVTFVLHTIVRGFFHSACGSLYAAVFPSNHFGTLTGLQSLISAVF    421 - 490
ALLQQPLFMAMVGPLKGEPFWVNLGLLLFSLLGFLLPSYLFYYRARLQQEYAANGMGPLKVLSGSEVTA     491 - 559
//

Text Mined References (12)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18195088 2008 Amino acid transport across mammalian intestinal and renal epithelia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12930836 2003 Identification of a novel system L amino acid transporter structurally distinct from heterodimeric amino acid transporters.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11956097 2002 New insights into testicular germ cell tumorigenesis from gene expression profiling.
9722952 1998 cDNA sequencing and analysis of POV1 (PB39): a novel gene up-regulated in prostate cancer.
9255310 1997 Identification of a novel transcript up-regulated in a clinically aggressive prostate carcinoma.
More...