Property Summary

NCBI Gene PubMed Count 13
PubMed Score 9.27
PubTator Score 5.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 3.97157056674543E-5
psoriasis 6685 4.81431373599689E-5
sonic hedgehog group medulloblastoma 1482 1.11499858082159E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0136687280004314
Disease Target Count Z-score Confidence
Retinitis pigmentosa 156 3.029 1.5
neural tube defect 8 3.011 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -2.200 0.000
osteosarcoma 2.499 0.000
pancreatic ductal adenocarcinoma liver m... 1.460 0.014
sonic hedgehog group medulloblastoma 1.200 0.000

Synonym

Accession O75386 B3KNB7 B7Z6A2 D3DUQ4 F8WBZ9 Q8N5B0
Symbols TUBL3

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (3)

PMID Text
24668219 Data demonstrated that pancreatic cancer patients exhibiting high transcriptional levels of TULP3 showed a poor overall survival rate.
22190034 HIV-1 Vpr is identified to have a physical interaction with tubby like protein 3 (TULP3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20634891 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEASRCRLSPSGDSVFHEEMMKMRQAKLDYQRLLLEKRQRKKRLEPFMVQPNPEARLRRAKPRASDEQTP      1 - 70
LVNCHTPHSNVILHGIDGPAAVLKPDEVHAPSVSSSVVEEDAENTVDTASKPGLQERLQKHDISESVNFD     71 - 140
EETDGISQSACLERPNSASSQNSTDTGTSGSATAAQPADNLLGDIDDLEDFVYSPAPQGVTVRCRIIRDK    141 - 210
RGMDRGLFPTYYMYLEKEENQKIFLLAARKRKKSKTANYLISIDPVDLSREGESYVGKLRSNLMGTKFTV    211 - 280
YDRGICPMKGRGLVGAAHTRQELAAISYETNVLGFKGPRKMSVIIPGMTLNHKQIPYQPQNNHDSLLSRW    281 - 350
QNRTMENLVELHNKAPVWNSDTQSYVLNFRGRVTQASVKNFQIVHKNDPDYIVMQFGRVADDVFTLDYNY    351 - 420
PLCAVQAFGIGLSSFDSKLACE                                                    421 - 442
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24668219 2014 Computational analyses reveal a prognostic impact of TULP3 as a transcriptional master regulator in pancreatic ductal adenocarcinoma.
23382074 2013 A high-confidence interaction map identifies SIRT1 as a mediator of acetylation of USP22 and the SAGA coactivator complex.
22190034 2011 Global landscape of HIV-human protein complexes.
20889716 2010 TULP3 bridges the IFT-A complex and membrane phosphoinositides to promote trafficking of G protein-coupled receptors into primary cilia.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...