Property Summary

NCBI Gene PubMed Count 14
PubMed Score 9.12
PubTator Score 5.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Gastrointestinal Stromal Tumors 48 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
neural tube defect 9 3.082 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 2.499 4.0e-05
pancreatic ductal adenocarcinoma liver m... 1.460 1.4e-02
psoriasis -2.200 4.8e-05
sonic hedgehog group medulloblastoma 1.100 2.9e-03

Gene RIF (3)

AA Sequence

MEASRCRLSPSGDSVFHEEMMKMRQAKLDYQRLLLEKRQRKKRLEPFMVQPNPEARLRRAKPRASDEQTP      1 - 70
LVNCHTPHSNVILHGIDGPAAVLKPDEVHAPSVSSSVVEEDAENTVDTASKPGLQERLQKHDISESVNFD     71 - 140
EETDGISQSACLERPNSASSQNSTDTGTSGSATAAQPADNLLGDIDDLEDFVYSPAPQGVTVRCRIIRDK    141 - 210
RGMDRGLFPTYYMYLEKEENQKIFLLAARKRKKSKTANYLISIDPVDLSREGESYVGKLRSNLMGTKFTV    211 - 280
YDRGICPMKGRGLVGAAHTRQELAAISYETNVLGFKGPRKMSVIIPGMTLNHKQIPYQPQNNHDSLLSRW    281 - 350
QNRTMENLVELHNKAPVWNSDTQSYVLNFRGRVTQASVKNFQIVHKNDPDYIVMQFGRVADDVFTLDYNY    351 - 420
PLCAVQAFGIGLSSFDSKLACE                                                    421 - 442
//

Text Mined References (15)

PMID Year Title