Property Summary

NCBI Gene PubMed Count 80
Grant Count 113
R01 Count 71
Funding $12,616,843.17
PubMed Score 293.54
PubTator Score 133.61

Knowledge Summary

Patent (4,969)

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.523 0.000
adult high grade glioma -1.400 0.000
pilocytic astrocytoma -1.300 0.000
posterior fossa group B ependymoma -1.100 0.000
subependymal giant cell astrocytoma -1.195 0.044

Synonym

Accession O75385 Q9UQ28
Symbols ATG1
ATG1A
UNC51
hATG1
Unc51.1

Gene

PDB

4WNO   4WNP   5CI7  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (61)

PMID Text
26687681 Study identifies a key role of Cul3-KLHL20 in autophagy termination by controlling autophagy-dependent turnover of ULK1 and VPS34 complex subunits and reveals the pathophysiological functions of this autophagy termination mechanism.
26310906 Concurrent mTORC1 inactivation and PP2A-B55alpha stimulation fuel ULK1-dependent autophagy.
26299944 Structure of the human Atg13-Atg101 HORMA heterodimer in the ULK1 complex that controls autophagy has been described.
26299883 Of several factors examined, bone metastasis, liver metastasis, and ULK1 expression were shown to have significant effects on the response to mTOR inhibitors.
26282792 KIM-1-/TIM-1-mediated phagocytosis links ATG5-/ULK1-dependent clearance of apoptotic cells to antigen presentation.
26207339 the inhibition of deubiquitinases by the compound WP1130 leads to increased ULK1 ubiquitination, the transfer of ULK1 to aggresomes, and the inhibition of ULK1 activity.
26183158 ULK1 could inhibit p70S6K in starvation-induced autophagy, and further identified that miR-4487 and miR-595 were novel ULK1 target miRNAs
26103054 ROS-AMPK-ULK1 mechanism that couples T3-induced mitochondrial turnover with activity, wherein mitophagy is necessary not only for removing damaged mitochondria but also for sustaining efficient OXPHOS
26018823 MUL1 ubiquitinates ULK1 and regulates selenite-induced mitophagy
25980607 conclude that AMPK-dependent phosphorylation of ULK1 is critical for translocation of ULK1 to mitochondria and for mitophagy in response to hypoxic stress
More...

AA Sequence

MEPGRGGTETVGKFEFSRKDLIGHGAFAVVFKGRHREKHDLEVAVKCINKKNLAKSQTLLGKEIKILKEL      1 - 70
KHENIVALYDFQEMANSVYLVMEYCNGGDLADYLHAMRTLSEDTIRLFLQQIAGAMRLLHSKGIIHRDLK     71 - 140
PQNILLSNPAGRRANPNSIRVKIADFGFARYLQSNMMAATLCGSPMYMAPEVIMSQHYDGKADLWSIGTI    141 - 210
VYQCLTGKAPFQASSPQDLRLFYEKNKTLVPTIPRETSAPLRQLLLALLQRNHKDRMDFDEFFHHPFLDA    211 - 280
SPSVRKSPPVPVPSYPSSGSGSSSSSSSTSHLASPPSLGEMQQLQKTLASPADTAGFLHSSRDSGGSKDS    281 - 350
SCDTDDFVMVPAQFPGDLVAEAPSAKPPPDSLMCSGSSLVASAGLESHGRTPSPSPPCSSSPSPSGRAGP    351 - 420
FSSSRCGASVPIPVPTQVQNYQRIERNLQSPTQFQTPRSSAIRRSGSTSPLGFARASPSPPAHAEHGGVL    421 - 490
ARKMSLGGGRPYTPSPQVGTIPERPGWSGTPSPQGAEMRGGRSPRPGSSAPEHSPRTSGLGCRLHSAPNL    491 - 560
SDLHVVRPKLPKPPTDPLGAVFSPPQASPPQPSHGLQSCRNLRGSPKLPDFLQRNPLPPILGSPTKAVPS    561 - 630
FDFPKTPSSQNLLALLARQGVVMTPPRNRTLPDLSEVGPFHGQPLGPGLRPGEDPKGPFGRSFSTSRLTD    631 - 700
LLLKAAFGTQAPDPGSTESLQEKPMEIAPSAGFGGSLHPGARAGGTSSPSPVVFTVGSPPSGSTPPQGPR    701 - 770
TRMFSAGPTGSASSSARHLVPGPCSEAPAPELPAPGHGCSFADPITANLEGAVTFEAPDLPEETLMEQEH    771 - 840
TEILRGLRFTLLFVQHVLEIAALKGSASEAAGGPEYQLQESVVADQISLLSREWGFAEQLVLYLKVAELL    841 - 910
SSGLQSAIDQIRAGKLCLSSTVKQVVRRLNELYKASVVSCQGLSLRLQRFFLDKQRLLDRIHSITAERLI    911 - 980
FSHAVQMVQSAALDEMFQHREGCVPRYHKALLLLEGLQHMLSDQADIENVTKCKLCIERRLSALLTGICA    981 - 1050
//

Text Mined References (92)

PMID Year Title
26687681 2016 Cul3-KLHL20 Ubiquitin Ligase Governs the Turnover of ULK1 and VPS34 Complexes to Control Autophagy Termination.
26347139 2015 TRIM-mediated precision autophagy targets cytoplasmic regulators of innate immunity.
26310906 2015 Regulation of autophagy by coordinated action of mTORC1 and protein phosphatase 2A.
26299944 2015 Structure of the Human Atg13-Atg101 HORMA Heterodimer: an Interaction Hub within the ULK1 Complex.
26299883 2015 UNC-51-like kinase 1 expression in radical nephrectomy specimens as a predicting factor of progression-free survival in patients with metastatic renal cell carcinoma treated with mammalian target of rapamycin inhibitors.
26282792 2015 KIM-1-/TIM-1-mediated phagocytosis links ATG5-/ULK1-dependent clearance of apoptotic cells to antigen presentation.
26207339 2015 Deubiquitinase inhibition by WP1130 leads to ULK1 aggregation and blockade of autophagy.
26183158 2015 Identification of ULK1 as a novel biomarker involved in miR-4487 and miR-595 regulation in neuroblastoma SH-SY5Y cell autophagy.
26103054 2015 Thyroid hormone induction of mitochondrial activity is coupled to mitophagy via ROS-AMPK-ULK1 signaling.
26018823 2015 Mitochondrial outer-membrane E3 ligase MUL1 ubiquitinates ULK1 and regulates selenite-induced mitophagy.
More...