Property Summary

NCBI Gene PubMed Count 18
PubMed Score 54.12
PubTator Score 5.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.037 5.2e-03
psoriasis 1.500 1.0e-04
ovarian cancer 1.700 1.2e-04

Gene RIF (10)

PMID Text
25470292 CD147 appears to regulate complex I activity and apoptosis in malignant melanoma cells by interacting with mitochondrial NDUFS6.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19064571 Observational study of gene-disease association. (HuGE Navigator)
19034380 This protein has been found differentially expressed in the temporal lobe from patients with schizophrenia.
18977241 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of NADH dehydrogenase (ubiquinone) Fe-S protein 6 (NADH-coenzyme Q reductase; NDUFS6) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
17601350 Observational study of gene-disease association. (HuGE Navigator)
17438127 NDUFS6 is required for the assembly and stabilization of a portion of complex I that contains a number of subunits.
15372108 NDUFS6, a complex I subunit gene not previously associated with complex I deficiency, was grossly underexpressed in t patient cell lines.

AA Sequence

MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAID      1 - 70
LIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH                     71 - 124
//

Text Mined References (21)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25470292 2014 CD147 interacts with NDUFS6 in regulating mitochondrial complex I activity and the mitochondrial apoptotic pathway in human malignant melanoma cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
19034380 2009 Alterations in oligodendrocyte proteins, calcium homeostasis and new potential markers in schizophrenia anterior temporal lobe are revealed by shotgun proteome analysis.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17438127 2007 Analysis of the assembly profiles for mitochondrial- and nuclear-DNA-encoded subunits into complex I.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372108 2004 NDUFS6 mutations are a novel cause of lethal neonatal mitochondrial complex I deficiency.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12611891 2003 The subunit composition of the human NADH dehydrogenase obtained by rapid one-step immunopurification.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9878551 1998 cDNA of eight nuclear encoded subunits of NADH:ubiquinone oxidoreductase: human complex I cDNA characterization completed.
9763677 1998 Intron based radiation hybrid mapping of 15 complex I genes of the human electron transport chain.
9647766 1998 cDNA sequence and chromosomal localization of the remaining three human nuclear encoded iron sulphur protein (IP) subunits of complex I: the human IP fraction is completed.