Property Summary

NCBI Gene PubMed Count 27
PubMed Score 20.13
PubTator Score 16.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
aldosterone-producing adenoma -1.286 1.5e-02
atypical teratoid / rhabdoid tumor -1.600 2.1e-06
cystic fibrosis -1.200 8.2e-04
ependymoma -1.100 1.4e-09
glioblastoma -1.100 1.8e-06
malignant mesothelioma -1.200 1.5e-06
medulloblastoma, large-cell -1.800 3.8e-06
ovarian cancer 1.400 1.3e-02
psoriasis 1.500 2.3e-03
tuberculosis and treatment for 6 months -1.300 2.9e-02

Gene RIF (7)

AA Sequence

MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQEN      1 - 70
ITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAAILLLVIIILIVMKYR     71 - 140
T//

Text Mined References (37)

PMID Year Title