Property Summary

NCBI Gene PubMed Count 25
Grant Count 7
R01 Count 7
Funding $453,278.15
PubMed Score 19.46
PubTator Score 16.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
psoriasis 1.500 0.002
ependymoma -1.100 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
glioblastoma -1.100 0.000
medulloblastoma, large-cell -1.800 0.000
tuberculosis and treatment for 6 months -1.300 0.029
cystic fibrosis -1.300 0.000
aldosterone-producing adenoma -1.286 0.015
ovarian cancer 1.400 0.013

Gene RIF (7)

PMID Text
23798538 Syntaxin 6 and VAMP4 colocalize to the chlamydial inclusion.
23741335 CALM is able to sort VAMP4 and VAMP7, even though they have sorting signals for other clathrin adaptors.
23677696 Data indicate that depletion of VAMP4, syntaxin 6, syntaxin 16, and Vti1a disrupted the Golgi ribbon structure.
23585472 colocalization of ATP11B with fluorescent cisplatin and with vesicular trafficking proteins, such as STX6 and VAMP4, strongly suggests that ATP11B contributes to secretory vesicular transport of cisplatin from Golgi to plasma membrane
22406549 The findings of this study suggested that VAMP4 and syb2 diverge functionally, traffic independently and support distinct forms of neurotransmission
21805468 VAMP7 is involved in many fusion processes and thus plays a more general function in NK-cell activity than VAMP4.
15896658 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQEN      1 - 70
ITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAAILLLVIIILIVMKYR     71 - 140
T//

Text Mined References (35)

PMID Year Title
26359495 2015 The Q-soluble N-Ethylmaleimide-sensitive Factor Attachment Protein Receptor (Q-SNARE) SNAP-47 Regulates Trafficking of Selected Vesicle-associated Membrane Proteins (VAMPs).
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23798538 2013 Vesicle-associated membrane protein 4 and syntaxin 6 interactions at the chlamydial inclusion.
23741335 2013 Uncoupling the functions of CALM in VAMP sorting and clathrin-coated pit formation.
23677696 2013 VAMP4 is required to maintain the ribbon structure of the Golgi apparatus.
23585472 2013 ATP11B mediates platinum resistance in ovarian cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22406549 2012 VAMP4 directs synaptic vesicles to a pool that selectively maintains asynchronous neurotransmission.
21805468 2011 VAMP4- and VAMP7-expressing vesicles are both required for cytotoxic granule exocytosis in NK cells.
More...