Property Summary

NCBI Gene PubMed Count 19
PubMed Score 7.42
PubTator Score 5.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 2.78219037166506E-18
juvenile dermatomyositis 1189 3.68795153031551E-10
malignant mesothelioma 3163 1.08726931346634E-9
tuberculosis 1563 1.31565862584688E-8
Duchenne muscular dystrophy 602 1.85237815837758E-8
ovarian cancer 8492 1.23148901515505E-6
Multiple myeloma 1328 9.39668679128693E-5
lung cancer 4473 1.06689511652389E-4
colon cancer 1475 1.41107344138959E-4
medulloblastoma, large-cell 6234 0.00273387785925496
fascioscapulohumeral muscular dystrophy 100 0.00416891270227394
limb girdle muscular dystrophy 2A 156 0.0046626733432804
dermatomyositis 967 0.00522378494969836
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00983549155920061
Waldenstrons macroglobulinemia 765 0.0203400546698434
Breast cancer 3099 0.0248609387717636
Disease Target Count Z-score Confidence
Cognitive disorder 44 0.0 1.0
Parkinson's disease 364 0.0 2.0
Disease Target Count Z-score Confidence
Down syndrome 548 4.148 2.1
Congenital heart disease 63 3.528 1.8

Expression

  Differential Expression (16)

Synonym

Accession O75368 Q3SYL1 Q5JT50 Q6FIE8 Q9H0N8
Symbols SH3BGR
HEL-S-115

Gene

PDB

1U6T   1WRY  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Zebrafish OMA EggNOG

Gene RIF (3)

PMID Text
20532202 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16186799 mutations in predicted EVH1-binding domain of SH3BGRL had a modest effect on suppression of v-Rel transformation. This study provides the first example of a gene that is downregulated in v-Rel-expressing cells also playng a role in v-Rel transformation
16080146 h-SH3BGRL should present a novel class of the thioredoxin fold proteins

AA Sequence

MVIRVYIASSSGSTAIKKKQQDVLGFLEANKIGFEEKDIAANEENRKWMRENVPENSRPATGYPLPPQIF      1 - 70
NESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA                               71 - 114
//

Text Mined References (20)

PMID Year Title
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20532202 2010 Use of genome-wide expression data to mine the "Gray Zone" of GWA studies leads to novel candidate obesity genes.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20029029 2009 Regulation of epidermal growth factor receptor trafficking by lysine deacetylase HDAC6.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16729043 2005 Phosphotyrosine interactome of the ErbB-receptor kinase family.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16186799 2006 The suppression of SH3BGRL is important for v-Rel-mediated transformation.
More...