Property Summary

NCBI Gene PubMed Count 19
Grant Count 5
R01 Count 5
Funding $250,484.16
PubMed Score 7.42
PubTator Score 5.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Gene RIF (3)

PMID Text
20532202 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16186799 mutations in predicted EVH1-binding domain of SH3BGRL had a modest effect on suppression of v-Rel transformation. This study provides the first example of a gene that is downregulated in v-Rel-expressing cells also playng a role in v-Rel transformation
16080146 h-SH3BGRL should present a novel class of the thioredoxin fold proteins

AA Sequence

MVIRVYIASSSGSTAIKKKQQDVLGFLEANKIGFEEKDIAANEENRKWMRENVPENSRPATGYPLPPQIF      1 - 70
NESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA                               71 - 114
//

Text Mined References (20)

PMID Year Title
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20532202 2010 Use of genome-wide expression data to mine the "Gray Zone" of GWA studies leads to novel candidate obesity genes.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20029029 2009 Regulation of epidermal growth factor receptor trafficking by lysine deacetylase HDAC6.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16729043 2005 Phosphotyrosine interactome of the ErbB-receptor kinase family.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16186799 2006 The suppression of SH3BGRL is important for v-Rel-mediated transformation.
More...