Property Summary

NCBI Gene PubMed Count 20
PubMed Score 8.56
PubTator Score 5.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
autosomal dominant Emery-Dreifuss muscul... 1.672 9.8e-03
Breast cancer 2.700 2.5e-02
colon cancer -1.500 1.4e-04
dermatomyositis 1.700 5.2e-03
Duchenne muscular dystrophy 2.353 1.9e-08
fascioscapulohumeral muscular dystrophy 1.083 4.2e-03
juvenile dermatomyositis 1.890 3.7e-10
limb girdle muscular dystrophy 2A 1.172 4.7e-03
lung cancer -1.500 9.2e-03
malignant mesothelioma -5.400 1.1e-09
medulloblastoma, large-cell -1.200 2.7e-03
Multiple myeloma 1.247 2.5e-04
non-small cell lung cancer -1.155 2.8e-18
ovarian cancer -2.500 1.2e-06
tuberculosis 1.200 1.2e-08
Waldenstrons macroglobulinemia 1.192 4.0e-03

Synonym

Accession O75368 Q3SYL1 Q5JT50 Q6FIE8 Q9H0N8
Symbols SH3BGR
HEL-S-115

Gene

PDB

1U6T   1WRY  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MVIRVYIASSSGSTAIKKKQQDVLGFLEANKIGFEEKDIAANEENRKWMRENVPENSRPATGYPLPPQIF      1 - 70
NESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA                               71 - 114
//

Text Mined References (21)

PMID Year Title