Property Summary

NCBI Gene PubMed Count 67
PubMed Score 69.64
PubTator Score 41.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
acute myeloid leukemia 1.200 1.2e-02
acute quadriplegic myopathy 1.324 3.3e-07
aldosterone-producing adenoma -1.091 1.4e-02
astrocytic glioma 1.100 2.8e-02
ductal carcinoma in situ 1.100 3.0e-05
esophageal adenocarcinoma -1.100 3.1e-02
glioblastoma 1.100 1.6e-03
group 3 medulloblastoma 1.400 1.0e-03
intraductal papillary-mucinous adenoma (... 1.300 9.0e-04
intraductal papillary-mucinous carcinoma... 1.500 6.2e-03
intraductal papillary-mucinous neoplasm ... 1.900 1.2e-02
invasive ductal carcinoma 1.300 1.5e-04
lung adenocarcinoma 1.409 2.3e-04
lung cancer 1.300 4.6e-04
malignant mesothelioma 1.200 1.2e-06
medulloblastoma, large-cell -1.300 1.7e-03
Multiple myeloma 1.503 8.1e-04
osteosarcoma 1.238 2.5e-04
ovarian cancer -1.100 2.4e-04
pancreatic ductal adenocarcinoma liver m... 1.176 9.2e-03
Pick disease 1.400 1.6e-06
psoriasis 1.300 9.4e-04
Rheumatoid arthritis 1.500 1.4e-02
tuberculosis 1.700 4.7e-09
Waldenstrons macroglobulinemia 2.103 1.5e-02

 GWAS Trait (1)

Gene RIF (33)

AA Sequence

MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARD      1 - 70
NKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGSKGKLEAIITPPPAKKAKSPS     71 - 140
QKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLGQKLNLIHSEISNLAGF    141 - 210
EVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPV    211 - 280
WGADKCEELLEKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVY    281 - 350
FVLFDSESIGIYVQEMAKLDAN                                                    351 - 372
//

Text Mined References (77)

PMID Year Title