Property Summary

NCBI Gene PubMed Count 67
Grant Count 38
R01 Count 28
Funding $3,714,765.55
PubMed Score 60.27
PubTator Score 41.39

Knowledge Summary

Patent

No data available

Expression

Gene RIF (33)

PMID Text
25959814 We show that composite nucleosomes containing mH2A and NRF-1 are stably positioned on gene regulatory regions and can buffer transcriptional noise associated with antiviral responses
25818643 The Skp2-mH2A1-CDK8 axis has a critical role in breast cancer development via dysregulation of the G2/M transition, polyploidy, cell growth dysregulation, and loss of tumor suppression.
25526730 High MacroH2A1 expression is associated with epigenetic markers for activation of lipogenic genes in fat-induced steatosis.
25306110 MacroH2A1.1 and PARP-1 cooperate to regulate transcription by promoting CBP-mediated H2B acetylation.
24911873 macroH2A1.1 expression correlates with poor survival of triple-negative breast cancer patients
24752897 MacroH2A1 specifically recruits PELP1 to the promoters of macroH2A1 target genes, but macroH2A1 occupancy occurs independent of PELP1. This recruitment allows macroH2A1 and PELP1 to cooperatively regulate gene expression outcomes.
24071584 The results demonstrate that macroH2A1 is a new factor involved in the regulation of rDNA transcription.
23595991 macro histone variants (macroH2A) are expressed at low levels in stem cells and are up-regulated during differentiation
23372727 Both macroH2A1 isoforms may play a role in hepatocellular carcinoma pathogenesis and may be considered as novel diagnostic markers for human hepatocellular carcinoma.
23031826 The histone variant macroH2A1.1 is recruited to DNA double-strand breaks through a mechanism involving PARP1.
More...

AA Sequence

MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARD      1 - 70
NKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGSKGKLEAIITPPPAKKAKSPS     71 - 140
QKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLGQKLNLIHSEISNLAGF    141 - 210
EVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPV    211 - 280
WGADKCEELLEKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVY    281 - 350
FVLFDSESIGIYVQEMAKLDAN                                                    351 - 372
//

Text Mined References (76)

PMID Year Title
26373281 2015 Loss of ATRX Suppresses Resolution of Telomere Cohesion to Control Recombination in ALT Cancer Cells.
25959814 2015 Composite macroH2A/NRF-1 Nucleosomes Suppress Noise and Generate Robustness in Gene Expression.
25818643 2015 Skp2-macroH2A1-CDK8 axis orchestrates G2/M transition and tumorigenesis.
25731851 2015 Nucleosome adaptability conferred by sequence and structural variations in histone H2A-H2B dimers.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25526730 2015 MacroH2A1 isoforms are associated with epigenetic markers for activation of lipogenic genes in fat-induced steatosis.
25416956 2014 A proteome-scale map of the human interactome network.
25362550 2015 A comprehensive view of the epigenetic landscape part I: DNA methylation, passive and active DNA demethylation pathways and histone variants.
25306110 2014 MacroH2A1.1 and PARP-1 cooperate to regulate transcription by promoting CBP-mediated H2B acetylation.
24911873 2014 Increased macroH2A1.1 expression correlates with poor survival of triple-negative breast cancer patients.
More...