Property Summary

Ligand Count 4
NCBI Gene PubMed Count 140
PubMed Score 30.30
PubTator Score 198.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma 1.294 9.2e-04
adult high grade glioma 1.100 6.9e-04
Astrocytoma, Pilocytic 2.000 8.4e-08
ependymoma 1.200 2.5e-03
glioblastoma 1.300 1.0e-04
group 3 medulloblastoma 2.300 2.6e-05
interstitial cystitis 2.000 2.0e-04
intraductal papillary-mucinous adenoma (... -1.400 2.0e-04
intraductal papillary-mucinous carcinoma... -1.300 5.3e-04
intraductal papillary-mucinous neoplasm ... -1.200 7.1e-03
malignant mesothelioma 3.600 6.5e-08
ovarian cancer 1.500 8.3e-04
periodontitis 1.600 1.8e-24
psoriasis -1.800 1.4e-04
ulcerative colitis 1.300 6.8e-03

Gene RIF (129)

AA Sequence

MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPF      1 - 70
DDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGA     71 - 140
INSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM                                         141 - 173
//

Text Mined References (140)

PMID Year Title