Property Summary

NCBI Gene PubMed Count 122
Grant Count 28
R01 Count 13
Funding $2,581,256.46
PubMed Score 29.64
PubTator Score 198.42

Knowledge Summary

Patent

No data available

Expression

Gene RIF (111)

PMID Text
27096756 Promotes uveal melanoma aggressiveness via membrane accumulation of matrix metalloproteinase 14 (MMP14)
26975394 PRL-3 has a role in the pathogenesis of prostate cancer.
26669864 Examination of clinical samples confirmed that USP4 expression positively correlates with PRL-3 protein expression, but not mRNA transcript levels.
26597054 PRL-3 provides a strategic survival advantage to tumour cells via its effects on mTOR.
26563151 Our findings suggested that PRL-3 genomic gain may represent an aggressive phenotype of primary colorectal cancer
26070892 PTP4A3 over expression independently predicted the metastasis and outcome of upper tract urothelial carcinoma, which was even more important in organ confined disease.
25687758 Data inticate that heat shock protein 60 (HSP60) interacted constitutively with NKG2D ligand ULBP2 and phosphatase of regenerating liver 3 (PRL-3) regulated HSP60 tyrosine phosphorylation.
25475733 miR-495 methylation-associated silencing inhibits the migration and invasion of human gastric cancer cells by directly targeting PRL-3
25139404 STAT3 binds to the -201 to -210 region of PRL-3. STAT3 functionally regulates PRL-3. STAT3 core signature was enriched in AML with high PRL-3 expression. The STAT3/PRL-3 regulatory loop contributes to the pathogenesis of AML.
25136802 These studies reveal a critical role of autophagy in PTP4A3-driven cancer progression.
More...

AA Sequence

MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPF      1 - 70
DDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGA     71 - 140
INSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM                                         141 - 173
//

Text Mined References (122)

PMID Year Title
27096756 2016 Protein Tyrosine Phosphatase 4A3 (PTP4A3) Promotes Human Uveal Melanoma Aggressiveness Through Membrane Accumulation of Matrix Metalloproteinase 14 (MMP14).
26975394 2016 Phosphatase of regenerating liver 3 (PRL-3) is overexpressed in human prostate cancer tissue and promotes growth and migration.
26669864 2016 Ubiquitin-Specific Protease 4-Mediated Deubiquitination and Stabilization of PRL-3 Is Required for Potentiating Colorectal Oncogenesis.
26597054 2015 PRL-3 activates mTORC1 in Cancer Progression.
26563151 2016 Genomic gain of the PRL-3 gene may represent poor prognosis of primary colorectal cancer, and associate with liver metastasis.
26070892 2015 PTP4A3 Independently Predicts Metastasis and Survival in Upper Tract Urothelial Carcinoma Treated with Radical Nephroureterectomy.
25687758 2015 PRL-3 mediates the protein maturation of ULBP2 by regulating the tyrosine phosphorylation of HSP60.
25475733 2015 Methylation-associated silencing of miR-495 inhibit the migration and invasion of human gastric cancer cells by directly targeting PRL-3.
25139404 2014 Phosphatase of regenerating liver-3 is regulated by signal transducer and activator of transcription 3 in acute myeloid leukemia.
25136802 2014 A role of autophagy in PTP4A3-driven cancer progression.
More...