Property Summary

NCBI Gene PubMed Count 45
PubMed Score 188.51
PubTator Score 89.18

Knowledge Summary

Patent

No data available

Expression

Gene RIF (44)

AA Sequence

MEFGLLSEAEARSPALSLSDAGTPHPQLPEHGCKGQEHSDSEKASASLPGGSPEDGSLKKKQRRQRTHFT      1 - 70
SQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERSQQAELCKGSFAAPLGGL     71 - 140
VPPYEEVYPGYSYGNWPPKALAPPLAAKTFPFAFNSVNVGPLASQPVFSPPSSIAASMVPSAAAAPGTVP    141 - 210
GPGALQGLGGGPPGLAPAAVSSGAVSCPYASAAAAAAAAASSPYVYRDPCNSSLASLRLKAKQHASFSYP    211 - 280
AVHGPPPAANLSPCQYAVERPV                                                    281 - 302
//

Text Mined References (46)

PMID Year Title