Property Summary

NCBI Gene PubMed Count 14
PubMed Score 10.03
PubTator Score 6.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Synonym

Accession O75363 A0AVG5 Q68CZ3
Symbols AIBC1
NABC1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MGNQMSVPQRVEDQENEPEAETYQDNASALNGVPVVVSTHTVQHLEEVDLGISVKTDNVATSSPETTEIS      1 - 70
AVADANGKNLGKEAKPEAPAAKSRFFLMLSRPVPGRTGDQAADSSLGSVKLDVSSNKAPANKDPSESWTL     71 - 140
PVAAGPGQDTDKTPGHAPAQDKVLSAARDPTLLPPETGGAGGEAPSKPKDSSFFDKFFKLDKGQEKVPGD    141 - 210
SQQEAKRAEHQDKVDEVPGLSGQSDDVPAGKDIVDGKEKEGQELGTADCSVPGDPEGLETAKDDSQAAAI    211 - 280
AENNNSIMSFFKTLVSPNKAETKKDPEDTGAEKSPTTSADLKSDKANFTSQETQGAGKNSKGCNPSGHTQ    281 - 350
SVTTPEPAKEGTKEKSGPTSLPLGKLFWKKSVKEDSVPTGAEENVVCESPVEIIKSKEVESALQTVDLNE    351 - 420
GDAAPEPTEAKLKREESKPRTSLMAFLRQMSVKGDGGITHSEEINGKDSSCQTSDSTEKTITPPEPEPTG    421 - 490
APQKGKEGSSKDKKSAAEMNKQKSNKQEAKEPAQCTEQATVDTNSLQNGDKLQKRPEKRQQSLGGFFKGL    491 - 560
GPKRMLDAQVQTDPVSIGPVGKSK                                                  561 - 584
//

Text Mined References (15)

PMID Year Title