Property Summary

NCBI Gene PubMed Count 65
PubMed Score 151.16
PubTator Score 305.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Pituitary Hormone Deficiency, Combined, 2 1 0.0 0.0
Disease Target Count
Pituitary hypoplasia 23
Hypogonadism 173
Hypothyroidism 122
Abdomen distended 43
Abnormal prolactin level 7
Abnormality of secondary sexual hair 6
Abnormality of the hypothalamus-pituitary axis 12
Adrenal gland hypofunction 9
Anterior pituitary agenesis 6
Anterior pituitary hypoplasia 13
Aplasia/Hypoplasia of the breasts 10
Autosomal recessive predisposition 1442
Central hypothyroidism 6
Cleft palate with cleft lip 23
Coarse facial features 108
Cognitive delay 608
Constipation 181
Decreased circulating ACTH level 12
Depressed nasal ridge 51
Dull intelligence 645
Dyschezia 135
Fatigue 182
Feeding difficulties 127
Generalized osteopenia 99
Global developmental delay 608
Hypoglycaemic seizure 10
Hypoglycemia 152
Hypogonadism, Isolated Hypogonadotropic 71
Hypogonadotropic hypogonadism 89
Hypotension 82
Icterus 82
Infertility 188
Intellectual disability 1016
Large bregma sutures 46
Large fontanelle 46
Large, late-closing fontanelle 46
Low intelligence 645
Mental Retardation 645
Mental and motor retardation 608
Mental deficiency 645
Muscle hypotonia 571
Neonatal hypoglycemia 17
Oral cleft 18
Osteopenia 99
Pituitary Dwarfism Type 3 3
Pituitary Hormone Deficiency, Combined, 1 6
Poor school performance 645
Prolactin Deficiency, Isolated 1
Secondary hypothyroidism 15
Septo-Optic Dysplasia 11
Short stature 531
Sleep disturbances 37
Small testicle 75
Thickened facial skin with coarse facial features 108
Umbilical hernia 93
Wide bregma sutures 46
menstrual periods stopped for over 6 months 13
Disease Target Count P-value
ovarian cancer 8520 1.9e-09

Synonym

Accession O75360 PROP-1
Symbols CPHD2
PROP-1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (49)

AA Sequence

MEAERRRQAEKPKKGRVGSNLLPERHPATGTPTTTVDSSAPPCRRLPGAGGGRSRFSPQGGQRGRPHSRR      1 - 70
RHRTTFSPVQLEQLESAFGRNQYPDIWARESLARDTGLSEARIQVWFQNRRAKQRKQERSLLQPLAHLSP     71 - 140
AAFSSFLPESTACPYSYAAPPPPVTCFPHPYSHALPSQPSTGGAFALSHQSEDWYPTLHPAPAGHLPCPP    141 - 210
PPPMLPLSLEPSKSWN                                                          211 - 226
//

Text Mined References (65)

PMID Year Title