Property Summary

NCBI Gene PubMed Count 23
PubMed Score 64.08
PubTator Score 73.34

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (11)

AA Sequence

MATSWGTVFFMLVVSCVCSAVSHRNQQTWFEGIFLSSMCPINVSASTLYGIMFDAGSTGTRIHVYTFVQK      1 - 70
MPGQLPILEGEVFDSVKPGLSAFVDQPKQGAETVQGLLEVAKDSIPRSHWKKTPVVLKATAGLRLLPEHK     71 - 140
AKALLFEVKEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTLDLGGASTQITFL    141 - 210
PQFEKTLEQTPRGYLTSFEMFNSTYKLYTHSYLGFGLKAARLATLGALETEGTDGHTFRSACLPRWLEAE    211 - 280
WIFGGVKYQYGGNQEGEVGFEPCYAEVLRVVRGKLHQPEEVQRGSFYAFSYYYDRAVDTDMIDYEKGGIL    281 - 350
KVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQLTKKVNNIETGWALGATFHL    351 - 420
LQSLGISH                                                                  421 - 428
//

Text Mined References (27)

PMID Year Title