Property Summary

NCBI Gene PubMed Count 23
Grant Count 11
R01 Count 10
Funding $976,236.8
PubMed Score 62.73
PubTator Score 73.34

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
25794010 Results suggest that ENTPD5 affects lung cancer apoptosis via Caspase 3 pathway, and can be potentially used to monitor prognosis or to guide appropriate therapeutic regimens.
25045656 The main point of this review is to integrate the findings and proposed theories about the role played by NTPDase5/mt-PCPH in cancer progression, considering that these proteins have been suggested as potential early diagnostic tools and therapy targets.
23921441 These results strongly suggest that the mt-PCPH ( ENTPD5)oncoprotein may regulate the cellular energy levels and subsequent chemoresistance by an NTPDase-independent mechanism
22992974 Upregulation of ENTPD5 is associated with altered metabolism in gliomablastoma multiforme.
22169232 The elevation of ENTPD5 activity therefore protects AKT-active cancer cells from protein-overloading-induced endoplasmic reticulum stress and the resulting growth arrest and apoptosis.
21074248 Study reports that ENTPD5, an endoplasmic reticulum (ER) enzyme, is upregulated in cell lines and primary human tumor samples with active AKT.
20601676 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19117992 Findings identify PCPH as an important participant in the chemotherapy response of prostate cancer cells and establish a role for PCPH-PKCalpha-Bcl-2 functional interactions in the drug response process.
18006831 PCPH/ENTPD5 expression enhances the invasiveness of human prostate cancer cells by a protein kinase C delta-dependent mechanism
16465363 Results positively identify PCPH as a good early molecular marker for testicular neoplasms, and strongly indicate that immunodetection of truncated PCPH polypeptides may be a useful diagnostic tool for testicular germ cell tumors.
More...

AA Sequence

MATSWGTVFFMLVVSCVCSAVSHRNQQTWFEGIFLSSMCPINVSASTLYGIMFDAGSTGTRIHVYTFVQK      1 - 70
MPGQLPILEGEVFDSVKPGLSAFVDQPKQGAETVQGLLEVAKDSIPRSHWKKTPVVLKATAGLRLLPEHK     71 - 140
AKALLFEVKEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTLDLGGASTQITFL    141 - 210
PQFEKTLEQTPRGYLTSFEMFNSTYKLYTHSYLGFGLKAARLATLGALETEGTDGHTFRSACLPRWLEAE    211 - 280
WIFGGVKYQYGGNQEGEVGFEPCYAEVLRVVRGKLHQPEEVQRGSFYAFSYYYDRAVDTDMIDYEKGGIL    281 - 350
KVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQLTKKVNNIETGWALGATFHL    351 - 420
LQSLGISH                                                                  421 - 428
//

Text Mined References (27)

PMID Year Title
25794010 2015 ENTPD5 induces apoptosis in lung cancer cells via regulating caspase 3 expression.
25416956 2014 A proteome-scale map of the human interactome network.
25045656 2014 NTPDase5/PCPH as a new target in highly aggressive tumors: a systematic review.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23921441 2013 The ENTPD5/mt-PCPH oncoprotein is a catalytically inactive member of the ectonucleoside triphosphate diphosphohydrolase family.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22992974 2012 ENTPD5-mediated modulation of ATP results in altered metabolism and decreased survival in gliomablastoma multiforme.
22169232 2011 ENTPD5, an endoplasmic reticulum UDPase, alleviates ER stress induced by protein overloading in AKT-activated cancer cells.
21074248 2010 The ER UDPase ENTPD5 promotes protein N-glycosylation, the Warburg effect, and proliferation in the PTEN pathway.
20601676 2010 Analysis of SNPs with an effect on gene expression identifies UBE2L3 and BCL3 as potential new risk genes for Crohn's disease.
More...