Property Summary

NCBI Gene PubMed Count 14
PubMed Score 32.80
PubTator Score 25.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.400 1.6e-03
astrocytic glioma -1.900 2.0e-03
Astrocytoma, Pilocytic -1.800 6.3e-06
atypical teratoid / rhabdoid tumor -2.400 2.0e-07
Endometriosis -1.733 4.6e-02
ependymoma -2.300 4.9e-04
glioblastoma -2.000 8.6e-08
group 3 medulloblastoma -2.400 3.7e-04
interstitial cystitis -1.700 4.4e-03
intraductal papillary-mucinous adenoma (... 1.700 2.7e-03
intraductal papillary-mucinous carcinoma... -1.600 2.3e-02
medulloblastoma, large-cell -2.300 7.0e-04
oligodendroglioma -1.700 5.2e-03
pancreatic cancer -1.400 2.1e-03
primary pancreatic ductal adenocarcinoma -1.402 2.1e-03
primitive neuroectodermal tumor -2.400 2.2e-04
spina bifida -1.981 1.2e-02

 GWAS Trait (1)

Gene RIF (6)

AA Sequence

MFTVLTRQPCEQAGLKALYRTPTIIALVVLLVSIVVLVSITVIQIHKQEVLPPGLKYGIVLDAGSSRTTV      1 - 70
YVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATA     71 - 140
GMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPH    141 - 210
GVETTGALDLGGASTQISFVAGEKMDLNTSDIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAMLLQNSP    211 - 280
TKNHLTNPCYPRDYSISFTMGHVFDSLCTVDQRPESYNPNDVITFEGTGDPSLCKEKVASIFDFKACHDQ    281 - 350
ETCSFDGVYQPKIKGPFVAFAGFYYTASALNLSGSFSLDTFNSSTWNFCSQNWSQLPLLLPKFDEVYARS    351 - 420
YCFSANYIYHLFVNGYKFTEETWPQIHFEKEVGNSSIAWSLGYMLSLTNQIPAESPLIRLPIEPPVFVGT    421 - 490
LAFFTAAALLCLAFLAYLCSATRRKRHSEHAFDHAVDSD                                   491 - 529
//

Text Mined References (17)

PMID Year Title