Property Summary

NCBI Gene PubMed Count 14
Grant Count 2
R01 Count 2
Funding $152,777.77
PubMed Score 33.31
PubTator Score 25.92

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O75355 B2R8D0 G5E9N0 O60495 Q8N6K2 NTPDase 3
Symbols HB6
CD39L3
NTPDase-3

Gene

 Grant Application (2)

Gene RIF (6)

PMID Text
26018728 Despite the increased level of NTPDase1 and NTPDase3 mRNA expression in chondrogenically induced MSCs, their activity toward ATP remains quite low.
24085034 NTPDase3 is the major ectonucleotidase in pancreatic beta-cells in multiple species and modulates insulin secretion by controlling activation of purinergic receptors.
20190036 Cystic fibrosis epithelia exhibit >50% lower NTPDase1 activity, protein, and mRNA levels than normal epithelia, whereas these parameters are threefold higher for NTPDase3.
19743837 Generation of a helical model for NTPDase3 suggests the importance of putative hydrogen bond interactions of conserved polar residues which are critical for enzyme expression, activity, and its susceptibility to membrane perturbations.
19120451 efficiently inhibit the NTPDase3expressed in insulin secreting human pancreatic islet cells in situ
15966724 NTPDase3 sequence revealed a high degree of structural fold similarity with a bacterial exopolyphosphatase

AA Sequence

MFTVLTRQPCEQAGLKALYRTPTIIALVVLLVSIVVLVSITVIQIHKQEVLPPGLKYGIVLDAGSSRTTV      1 - 70
YVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATA     71 - 140
GMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPH    141 - 210
GVETTGALDLGGASTQISFVAGEKMDLNTSDIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAMLLQNSP    211 - 280
TKNHLTNPCYPRDYSISFTMGHVFDSLCTVDQRPESYNPNDVITFEGTGDPSLCKEKVASIFDFKACHDQ    281 - 350
ETCSFDGVYQPKIKGPFVAFAGFYYTASALNLSGSFSLDTFNSSTWNFCSQNWSQLPLLLPKFDEVYARS    351 - 420
YCFSANYIYHLFVNGYKFTEETWPQIHFEKEVGNSSIAWSLGYMLSLTNQIPAESPLIRLPIEPPVFVGT    421 - 490
LAFFTAAALLCLAFLAYLCSATRRKRHSEHAFDHAVDSD                                   491 - 529
//

Text Mined References (17)

PMID Year Title
26018728 2015 Chondrogenic Differentiation of Human Mesenchymal Stem Cells Results in Substantial Changes of Ecto-Nucleotides Metabolism.
25416956 2014 A proteome-scale map of the human interactome network.
24085034 2013 Ectonucleotidase NTPDase3 is abundant in pancreatic ?-cells and regulates glucose-induced insulin secretion.
20190036 2010 Cystic fibrosis remodels the regulation of purinergic signaling by NTPDase1 (CD39) and NTPDase3.
19743837 2009 Conserved polar residues stabilize transmembrane domains and promote oligomerization in human nucleoside triphosphate diphosphohydrolase 3.
19120451 2009 Characterization of a monoclonal antibody as the first specific inhibitor of human NTP diphosphohydrolase-3 : partial characterization of the inhibitory epitope and potential applications.
17727821 2007 Inhibition of human and mouse plasma membrane bound NTPDases by P2 receptor antagonists.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15966724 2005 Characterization of disulfide bonds in human nucleoside triphosphate diphosphohydrolase 3 (NTPDase3): implications for NTPDase structural modeling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...