Property Summary

NCBI Gene PubMed Count 20
PubMed Score 8.09
PubTator Score 7.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 6.4e-09
ependymoma -1.200 2.0e-12
group 4 medulloblastoma -1.100 1.6e-05
intraductal papillary-mucinous carcinoma... 1.600 6.6e-04
intraductal papillary-mucinous neoplasm ... 1.500 1.1e-03
lung cancer 1.100 2.1e-04
medulloblastoma, large-cell -1.200 4.0e-04
ovarian cancer 1.600 2.9e-05
Pick disease -1.100 2.2e-03

 GWAS Trait (1)

Gene RIF (3)

AA Sequence

MKKGIRYETSRKTSYIFQQPQHGPWQTRMRKISNHGSLRVAKVAYPLGLCVGVFIYVAYIKWHRATATQA      1 - 70
FFSITRAAPGARWGQQAHSPLGTAADGHEVFYGIMFDAGSTGTRVHVFQFTRPPRETPTLTHETFKALKP     71 - 140
GLSAYADDVEKSAQGIRELLDVAKQDIPFDFWKATPLVLKATAGLRLLPGEKAQKLLQKVKKVFKASPFL    141 - 210
VGDDCVSIMNGTDEGVSAWITINFLTGSLKTPGGSSVGMLDLGGGSTQIAFLPRVEGTLQASPPGYLTAL    211 - 280
RMFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSPSFKGEWEHAEVTYRVSGQKAAA    281 - 350
SLHELCAARVSEVLQNRVHRTEEVKHVDFYAFSYYYDLAAGVGLIDAEKGGSLVVGDFEIAAKYVCRTLE    351 - 420
TQPQSSPFSCMDLTYVSLLLQEFGFPRSKVLKLTRKIDNVETSWALGAIFHYIDSLNRQKSPAS          421 - 484
//

Text Mined References (21)

PMID Year Title