Property Summary

NCBI Gene PubMed Count 34
PubMed Score 6.43
PubTator Score 2.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.200 2.9e-02
intraductal papillary-mucinous neoplasm ... 1.200 9.9e-03
Multiple myeloma 1.344 2.9e-03
oligodendroglioma -1.100 3.7e-02
osteosarcoma 2.430 7.8e-06
ovarian cancer 1.400 3.0e-03
pancreatic ductal adenocarcinoma liver m... -1.308 9.8e-04
Parkinson's disease -1.100 8.7e-03
psoriasis 2.200 4.2e-05
subependymal giant cell astrocytoma 1.286 1.3e-02

Protein-protein Interaction (4)

Gene RIF (4)

AA Sequence

MASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKAKEAAALGSRGSCS      1 - 70
TEVEKETQEKMTILQTYFRQNRDEVLDNLLAFVCDIRPEIHENYRING                           71 - 118
//

Text Mined References (37)

PMID Year Title