Property Summary

NCBI Gene PubMed Count 32
PubMed Score 6.10
PubTator Score 2.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Synonym

Accession O75348 Q6IB33 V-ATPase subunit G 1
Symbols ATP6G
ATP6J
Vma10
ATP6G1
ATP6GL

Gene

Gene RIF (3)

PMID Text
26312577 genome-wide association study in population in China: Data suggest 4 SNPs upstream of ATP6V1G1 (rs10817638, rs7851259, rs10982287, rs4979427) are associated (in bivariate manner) with age at menarche and bone density. [includes META-ANALYSIS]
26180254 RILP regulates vacuolar ATPase through interaction with the V1G1 subunit
24762812 RILP regulates the activity of the V-ATPase through its interaction with V1G1.

AA Sequence

MASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKAKEAAALGSRGSCS      1 - 70
TEVEKETQEKMTILQTYFRQNRDEVLDNLLAFVCDIRPEIHENYRING                           71 - 118
//

Text Mined References (35)

PMID Year Title
26312577 2015 Bivariate Genome-Wide Association Study Implicates ATP6V1G1 as a Novel Pleiotropic Locus Underlying Osteoporosis and Age at Menarche.
26180254 2015 RILP regulates vacuolar ATPase through interaction with the V1G1 subunit.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24762812 2014 RILP regulates vacuolar ATPase through interaction with the V1G1 subunit.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22982048 2012 Lipofuscin is formed independently of macroautophagy and lysosomal activity in stress-induced prematurely senescent human fibroblasts.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...