Property Summary

NCBI Gene PubMed Count 32
PubMed Score 6.10
PubTator Score 2.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 7.8048390905207E-6
psoriasis 6685 4.23117201439602E-5
pancreatic ductal adenocarcinoma liver metastasis 1795 9.81657355611793E-4
Multiple myeloma 1328 0.00291999353811124
ovarian cancer 8492 0.00298455784877716
Parkinson's disease 364 0.00874012093113765
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00991915542533197
subependymal giant cell astrocytoma 2287 0.012620954006244
astrocytic glioma 2241 0.0286497858969181
oligodendroglioma 2849 0.036601161936192

Expression

  Differential Expression (10)

Synonym

Accession O75348 Q6IB33 V-ATPase subunit G 1
Symbols ATP6G
ATP6J
Vma10
ATP6G1
ATP6GL

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (3)

PMID Text
26312577 genome-wide association study in population in China: Data suggest 4 SNPs upstream of ATP6V1G1 (rs10817638, rs7851259, rs10982287, rs4979427) are associated (in bivariate manner) with age at menarche and bone density. [includes META-ANALYSIS]
26180254 RILP regulates vacuolar ATPase through interaction with the V1G1 subunit
24762812 RILP regulates the activity of the V-ATPase through its interaction with V1G1.

AA Sequence

MASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKAKEAAALGSRGSCS      1 - 70
TEVEKETQEKMTILQTYFRQNRDEVLDNLLAFVCDIRPEIHENYRING                           71 - 118
//

Text Mined References (35)

PMID Year Title
26312577 2015 Bivariate Genome-Wide Association Study Implicates ATP6V1G1 as a Novel Pleiotropic Locus Underlying Osteoporosis and Age at Menarche.
26180254 2015 RILP regulates vacuolar ATPase through interaction with the V1G1 subunit.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24762812 2014 RILP regulates vacuolar ATPase through interaction with the V1G1 subunit.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22982048 2012 Lipofuscin is formed independently of macroautophagy and lysosomal activity in stress-induced prematurely senescent human fibroblasts.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...