Property Summary

NCBI Gene PubMed Count 17
PubMed Score 78.51
PubTator Score 32.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Cardiomyopathy, Hypertrophic 24 0.0 0.0
Disease Target Count
Hypertrophic Cardiomyopathy 117
Disease Target Count P-value
diabetes mellitus 1728 3.0e-03
osteosarcoma 7950 4.8e-03

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.300 3.0e-03
osteosarcoma 1.128 4.8e-03

Gene RIF (5)

AA Sequence

MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRR      1 - 70
LEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA                                     71 - 108
//

Text Mined References (21)

PMID Year Title