Property Summary

NCBI Gene PubMed Count 17
Grant Count 10
R01 Count 8
Funding $1,271,960.16
PubMed Score 75.90
PubTator Score 32.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.128 0.005
diabetes mellitus -1.300 0.003

Gene RIF (5)

PMID Text
23740643 overexpression of TBCA did not induce biocharacteristics that directly contrasted to those of TBCA knockdown
20950786 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
15963512 TBCA is essential for cell viability and its knockdown produces a decrease in the amount of soluble tubulin, modifications in microtubules and G1 cell cycle arrest.

AA Sequence

MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRR      1 - 70
LEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA                                     71 - 108
//

Text Mined References (21)

PMID Year Title
23740643 2013 Tubulin cofactor A functions as a novel positive regulator of ccRCC progression, invasion and metastasis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20950786 2010 A genome-wide study reveals copy number variants exclusive to childhood obesity cases.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...