Property Summary

NCBI Gene PubMed Count 17
PubMed Score 75.90
PubTator Score 32.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Hypertrophic Cardiomyopathy 56
Disease Target Count P-value
diabetes mellitus 1663 0.00298781736007681
osteosarcoma 7933 0.00482887470853133

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.128 0.005
diabetes mellitus -1.300 0.003

Synonym

Accession O75347 B4DT30
Symbols

Gene

PANTHER Protein Class (2)

PDB

1H7C  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid

Gene RIF (5)

PMID Text
23740643 overexpression of TBCA did not induce biocharacteristics that directly contrasted to those of TBCA knockdown
20950786 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
15963512 TBCA is essential for cell viability and its knockdown produces a decrease in the amount of soluble tubulin, modifications in microtubules and G1 cell cycle arrest.

AA Sequence

MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRR      1 - 70
LEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA                                     71 - 108
//

Text Mined References (21)

PMID Year Title
23740643 2013 Tubulin cofactor A functions as a novel positive regulator of ccRCC progression, invasion and metastasis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20950786 2010 A genome-wide study reveals copy number variants exclusive to childhood obesity cases.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...