Property Summary

NCBI Gene PubMed Count 21
Grant Count 5
Funding $692,207
PubMed Score 19.73
PubTator Score 12.88

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
24241165 Genome wide DNA methylation assessment approach identified novel biomarkers that differentiate between cervical cancer and normal samples. In the Validation cohort FKBP6 promoter methylation had 73% sensitivity and 80% specificity (AUC = 0.80).
22082156 Knockdown of FK506 binding protein 6, 36kDa (FKBP6) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
20378615 Observational study of gene-disease association. (HuGE Navigator)
19001379 FKBP36 diminishes GAPDH activity by direct interaction and down-regulation of GAPDH
18529014 clathrin-FKBP36-Hsp72 complexes resulting from both identified interactions are bound to the matrices of clathrin-coated vesicles in spermatocytes, which indicates a possible role of FKBP36 and Hsp72 in the disassembly of clathrin coats
17307919 Observational study of gene-disease association. (HuGE Navigator)
17307919 may play a role in modifying the susceptibility to idiopathic spermatogenic impairment in human; allele A of c.216C>A seems to be a protective factor for the development of male infertility
16227348 Observational study of gene-disease association. (HuGE Navigator)
15696470 278A polymorphism of FKBP6 gene was associated with idiopathic azoospermia, while C/T, 370G/A, 430G/C, 467T/C, 468G/A polymorphisms might be very rare in Chinese population.
15696470 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGGSALNQGVLEGDDAPGQSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDASVLVKYSGYLEHMDR      1 - 70
PFDSNYFRKTPRLMKLGEDITLWGMELGLLSMRRGELARFLFKPNYAYGTLGCPPLIPPNTTVLFEIELL     71 - 140
DFLDCAESDKFCALSAEQQDQFPLQKVLKVAATEREFGNYLFRQNRFYDAKVRYKRALLLLRRRSAPPEE    141 - 210
QHLVEAAKLPVLLNLSFTYLKLDRPTIALCYGEQALIIDQKNAKALFRCGQACLLLTEYQKARDFLVRAQ    211 - 280
KEQPFNHDINNELKKLASCYRDYVDKEKEMWHRMFAPCGDGSTAGES                           281 - 327
//

Text Mined References (23)

PMID Year Title
26567527 2015 Involvement of FKBP6 in hepatitis C virus replication.
25416956 2014 A proteome-scale map of the human interactome network.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24241165 2014 Genome-wide methylation profiling reveals Zinc finger protein 516 (ZNF516) and FK-506-binding protein 6 (FKBP6) promoters frequently methylated in cervical neoplasia, associated with HPV status and ethnicity in a Chilean population.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
19001379 2009 FKBP36 is an inherent multifunctional glyceraldehyde-3-phosphate dehydrogenase inhibitor.
18529014 2008 FKBP36 forms complexes with clathrin and Hsp72 in spermatocytes.
17307919 2007 Mutation screening of the FKBP6 gene and its association study with spermatogenic impairment in idiopathic infertile men.
16983454 2006 Is a genetic defect in Fkbp6 a common cause of azoospermia in humans?
More...