Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 2.14

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
20451256 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18565106 Findings suggest that the soluble guanylyl cyclase (sGC) beta2 5'-UTRs have internal ribosome entry site activity that may permit sGC beta2 expression under conditions that are not optimal for scanning-dependent translation.

AA Sequence

MSGYDRMLRTLGGNLMEFIENLDALHSYLALSYQEMNAPSFRVERGADGKMFLHYYSDRSGLCHIVPGII      1 - 70
EAVAKDFFDIDVIMDILDMNEEVERTGKKEHVVFLIVQKAHRKMRKTKPKRLQDSQGMERDQEALQAAFL     71 - 140
KMKEKYLNVSACPVKKSHWDVVRSIVMFGKGHLMNTFEPIYPERLWIEEKTFCNAFPFHIVFDESLQVKQ    141 - 210
ARVNIQKYVPGLQTQNIQLDEYFSIIHPQVTFNIFSIRRFINSQFVLKTRREMMPVAWQSRTTLKLQGQM    211 - 280
IWMESMWCMVYLCSPKLRSLQELEELNMHLSDIAPNDTTRDLILLNQQRLAEIELSNQLERKKEELQVLS    281 - 350
KHLAIEKKKTETLLYAMLPKHVANQLREGKKVAAGEFKSCTILFSDVVTFTNICTACEPIQIVNVLNSMY    351 - 420
SKFDRLTSVHAVYKVETIGDAYMVVGGVPVPIGNHAQRVANFALGMRISAKEVTNPVTGEPIQLRVGIHT    421 - 490
GPVLADVVGDKMPRYCLFGDTVNTASRMESHGLPNKVHLSPTAYRALKNQGFKIIERGEIEVKGKGRMTT    491 - 560
YFLIQNLNATEDEIMGRSKTPVDHKGSTQKASLPTTKLQGSVQPSCPEHSSLASWLL                 561 - 617
//

Text Mined References (9)

PMID Year Title
24532677 2015 A genome-wide association study of rheumatoid arthritis without antibodies against citrullinated peptides.
20451256 2010 A genome-wide association study of bipolar disorder in Norwegian individuals, followed by replication in Icelandic sample.
18565106 2008 An internal ribosome entry site mediates the initiation of soluble guanylyl cyclase beta2 mRNA translation.
10777682 2000 The beta(2) subunit of soluble guanylyl cyclase contains a human-specific frameshift and is expressed in gastric carcinoma.
10717006 2000 Rapid desensitization of the nitric oxide receptor, soluble guanylyl cyclase, underlies diversity of cellular cGMP responses.
10677588 2000 Expression of nitric oxide-sensitive guanylyl cyclase subunits in human corpus cavernosum.
10449911 1999 Assignment of GUCY1B2, the human homologue of a candidate gene for hypertension, to chromosome bands 13q14.2-->q14.3 by in situ hybridization.
9889008 1999 Assignment of GUCY1B2, the gene coding for the beta2 subunit of human guanylyl cyclase to chromosomal band 13q14.3 between markers D13S168 and D13S155.
1980215 1990 A new form of guanylyl cyclase is preferentially expressed in rat kidney.