Property Summary

NCBI Gene PubMed Count 60
Grant Count 3
Funding $62,251.14
PubMed Score 56.51
PubTator Score 36.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.200 0.021
Pick disease -1.200 0.000
ovarian cancer 1.900 0.000

Synonym

Accession O75340 B2RD16 E7ESR3 Q2YDC2 Q5TZS0
Symbols ALG2
ALG-2
PEF1B

Gene

PDB

2ZNE   3WXA   2ZN8   2ZN9   2ZND   2ZRS   2ZRT   3AAJ   3AAK  

Gene RIF (29)

PMID Text
25362542 Our results suggest that PDCD6 may play an important role in the pathogenesis of cervical squamous cell carcinoma
24792888 PDCD6 may represent a biomarker candidate gene that could help to identify a group of patients at high risk for recurrence and death.
24078636 CHERP and ALG-2 participate in regulation of alternative splicing of IP3R1 pre-mRNA and provide new insights into post-transcriptional regulation of splicing variants in Ca(2+) signaling pathways.
23649269 the binding of ALG-2 to IST1 is Ca(2+)-dependent
23551056 The present study provided evidence that rs4957014 and rs3756712 are associated with Uterine leiomyoma (UL) risk, the results indicated that genetic polymorphisms in PDCD6 may contribute to the development of UL.
23350699 Palmitoylation sites and the N-terminal Pro-rich region were necessary for efficient secretion, but ABSs (ALG-2-binding sites) were dispensable.
23167403 The results of this study show that rs4957014G/T is associated with an increased risk of non-small cell lung cancer (NSCLC), which suggest that PDCD6 gene single nucleotide polymorphism is a risk factor for susceptibility of NSCLC.
23137875 the current study indicates that PDCD6 gene may be a new susceptibility gene to endometriosis.
22712728 we conclude that a novel p53-responsive gene PDCD6 is accumulated in the nucleus and induces apoptosis in response to DNA damage.
22369209 PDCD6 seems to play an important role in ovarian cancer progression.
More...

AA Sequence

MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIIS      1 - 70
MFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDR     71 - 140
QGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV                       141 - 191
//

Text Mined References (67)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25362542 2015 Single nucleotide polymorphisms in PDCD6 gene are associated with the development of cervical squamous cell carcinoma.
24792888 2014 Prognostic value of PDCD6 polymorphisms and the susceptibility to bladder cancer.
24078636 2013 Nuclear ALG-2 protein interacts with Ca2+ homeostasis endoplasmic reticulum protein (CHERP) Ca2+-dependently and participates in regulation of alternative splicing of inositol trisphosphate receptor type 1 (IP3R1) pre-mRNA.
23924735 2013 VPS37 isoforms differentially modulate the ternary complex formation of ALIX, ALG-2, and ESCRT-I.
23649269 2013 Mammalian ESCRT-III-related protein IST1 has a distinctive met-pro repeat sequence that is essential for interaction with ALG-2 in the presence of Ca2+.
23551056 2013 Variations in the PDCD6 gene are associated with increased uterine leiomyoma risk in the Chinese.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...