Property Summary

NCBI Gene PubMed Count 71
PubMed Score 59.06
PubTator Score 36.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Endogenous depression 8
Disease Target Count P-value
Pick disease 1894 4.7e-06
ovarian cancer 8520 1.2e-04
non primary Sjogren syndrome sicca 891 2.1e-02
Disease Target Count Z-score Confidence
Ovarian cystadenoma 5 3.341 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.200 2.1e-02
ovarian cancer 1.900 1.2e-04
Pick disease -1.200 4.7e-06

Gene RIF (35)

AA Sequence

MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIIS      1 - 70
MFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDR     71 - 140
QGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV                       141 - 191
//

Text Mined References (78)

PMID Year Title