Property Summary

NCBI Gene PubMed Count 23
Grant Count 6
Funding $1,581,903.83
PubMed Score 31.92
PubTator Score 33.68

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
22107760 CILP is involved in the etiology of intervertebral disc degeneration among young adults.
20724643 The researchers found that the single nucleotide polymorphism (1184T/C) of the CILP gene is associated an increased risk of lumbar disc degeneration in male athletes.
20724643 Observational study of gene-disease association. (HuGE Navigator)
19569011 the CILP gene 1184T/C polymorphism is a significant risk factor for lumbar disc degeneration occurrence in Japanese collegiate judo athletes
17220213 SNP analysis suggested that the CILP gene is not a major risk factor for symptoms of lumbar disc disease in Finnish or Chinese populations.
16453284 Observational study of gene-disease association. (HuGE Navigator)
16413503 These observations, together with the finding that CILP protein binds and inhibits TGF-beta1, suggest that CILP and TGF-beta1 may form a functional feedback loop that controls chondrocyte metabolism.
15864306 CILP regulates TGF-beta signaling and that this regulation has a crucial role in the etiology and pathogenesis of LDD.

AA Sequence

MVGTKAWVFSFLVLEVTSVLGRQTMLTQSVRRVQPGKKNPSIFAKPADTLESPGEWTTWFNIDYPGGKGD      1 - 70
YERLDAIRFYYGDRVCARPLRLEARTTDWTPAGSTGQVVHGSPREGFWCLNREQRPGQNCSNYTVRFLCP     71 - 140
PGSLRRDTERIWSPWSPWSKCSAACGQTGVQTRTRICLAEMVSLCSEASEEGQHCMGQDCTACDLTCPMG    141 - 210
QVNADCDACMCQDFMLHGAVSLPGGAPASGAAIYLLTKTPKLLTQTDSDGRFRIPGLCPDGKSILKITKV    211 - 280
KFAPIVLTMPKTSLKAATIKAEFVRAETPYMVMNPETKARRAGQSVSLCCKATGKPRPDKYFWYHNDTLL    281 - 350
DPSLYKHESKLVLRKLQQHQAGEYFCKAQSDAGAVKSKVAQLIVIASDETPCNPVPESYLIRLPHDCFQN    351 - 420
ATNSFYYDVGRCPVKTCAGQQDNGIRCRDAVQNCCGISKTEEREIQCSGYTLPTKVAKECSCQRCTETRS    421 - 490
IVRGRVSAADNGEPMRFGHVYMGNSRVSMTGYKGTFTLHVPQDTERLVLTFVDRLQKFVNTTKVLPFNKK    491 - 560
GSAVFHEIKMLRRKKPITLEAMETNIIPLGEVVGEDPMAELEIPSRSFYRQNGEPYIGKVKASVTFLDPR    561 - 630
NISTATAAQTDLNFINDEGDTFPLRTYGMFSVDFRDEVTSEPLNAGKVKVHLDSTQVKMPEHISTVKLWS    631 - 700
LNPDTGLWEEEGDFKFENQRRNKREDRTFLVGNLEIRERRLFNLDVPESRRCFVKVRAYRSERFLPSEQI    701 - 770
QGVVISVINLEPRTGFLSNPRAWGRFDSVITGPNGACVPAFCDDQSPDAYSAYVLASLAGEELQAVESSP    771 - 840
KFNPNAIGVPQPYLNKLNYRRTDHEDPRVKKTAFQISMAKPRPNSAEESNGPIYAFENLRACEEAPPSAA    841 - 910
HFRFYQIEGDRYDYNTVPFNEDDPMSWTEDYLAWWPKPMEFRACYIKVKIVGPLEVNVRSRNMGGTHRQT    911 - 980
VGKLYGIRDVRSTRDRDQPNVSAACLEFKCSGMLYDQDRVDRTLVKVIPQGSCRRASVNPMLHEYLVNHL    981 - 1050
PLAVNNDTSEYTMLAPLDPLGHNYGIYTVTDQDPRTAKEIALGRCFDGTSDGSSRIMKSNVGVALTFNCV   1051 - 1120
ERQVGRQSAFQYLQSTPAQSPAAGTVQGRVPSRRQQRASRGGQRQGGVVASLRFPRVAQQPLIN         1121 - 1184
//

Text Mined References (26)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
22107760 2011 Genetic susceptibility of intervertebral disc degeneration among young Finnish adults.
20724643 2010 Cartilage intermediate layer protein gene is associated with lumbar disc degeneration in male, but not female, collegiate athletes.
19569011 2009 The cartilage intermediate layer protein gene is associated with lumbar disc degeneration in collegiate judokas.
17220213 2007 Phenotypic and population differences in the association between CILP and lumbar disc disease.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16453284 2006 Reproducible genetic associations between candidate genes and clinical knee osteoarthritis in men and women.
16413503 2006 Transcriptional regulation of the cartilage intermediate layer protein (CILP) gene.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...