Property Summary

NCBI Gene PubMed Count 23
PubMed Score 31.92
PubTator Score 33.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count
Intervertebral disc disorder 7
Disease Target Count P-value
psoriasis 6685 9.22193715391862E-36
Duchenne muscular dystrophy 602 1.40535205643089E-10
ovarian cancer 8492 3.21101329727629E-6
Breast cancer 3099 5.5743824792553E-6
limb girdle muscular dystrophy 2A 156 5.63788169178873E-6
medulloblastoma, large-cell 6234 8.07677393076495E-6
lung adenocarcinoma 2714 8.95528690140873E-6
Becker muscular dystrophy 187 6.8877108103056E-5
osteosarcoma 7933 1.33817824185675E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 2.55742195538675E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 5.29776807900819E-4
Atopic dermatitis 944 9.1202908904649E-4
adult high grade glioma 2148 0.00116474814436976
diabetes mellitus 1663 0.0015958651724622
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00191582439277905
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00583520821606922
facioscapulohumeral dystrophy 286 0.00814178629232446
colon cancer 1475 0.00972730368149239
fibroadenoma 557 0.0214283748392424
spina bifida 1064 0.0469664223876046
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count
Intervertebral disc disease 6

Expression

Synonym

Accession O75339 B2R8F7 Q6UW99 Q8IYI5 CILP-1
Symbols CILP-1
HsT18872

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (8)

PMID Text
22107760 CILP is involved in the etiology of intervertebral disc degeneration among young adults.
20724643 The researchers found that the single nucleotide polymorphism (1184T/C) of the CILP gene is associated an increased risk of lumbar disc degeneration in male athletes.
20724643 Observational study of gene-disease association. (HuGE Navigator)
19569011 the CILP gene 1184T/C polymorphism is a significant risk factor for lumbar disc degeneration occurrence in Japanese collegiate judo athletes
17220213 SNP analysis suggested that the CILP gene is not a major risk factor for symptoms of lumbar disc disease in Finnish or Chinese populations.
16453284 Observational study of gene-disease association. (HuGE Navigator)
16413503 These observations, together with the finding that CILP protein binds and inhibits TGF-beta1, suggest that CILP and TGF-beta1 may form a functional feedback loop that controls chondrocyte metabolism.
15864306 CILP regulates TGF-beta signaling and that this regulation has a crucial role in the etiology and pathogenesis of LDD.

AA Sequence

MVGTKAWVFSFLVLEVTSVLGRQTMLTQSVRRVQPGKKNPSIFAKPADTLESPGEWTTWFNIDYPGGKGD      1 - 70
YERLDAIRFYYGDRVCARPLRLEARTTDWTPAGSTGQVVHGSPREGFWCLNREQRPGQNCSNYTVRFLCP     71 - 140
PGSLRRDTERIWSPWSPWSKCSAACGQTGVQTRTRICLAEMVSLCSEASEEGQHCMGQDCTACDLTCPMG    141 - 210
QVNADCDACMCQDFMLHGAVSLPGGAPASGAAIYLLTKTPKLLTQTDSDGRFRIPGLCPDGKSILKITKV    211 - 280
KFAPIVLTMPKTSLKAATIKAEFVRAETPYMVMNPETKARRAGQSVSLCCKATGKPRPDKYFWYHNDTLL    281 - 350
DPSLYKHESKLVLRKLQQHQAGEYFCKAQSDAGAVKSKVAQLIVIASDETPCNPVPESYLIRLPHDCFQN    351 - 420
ATNSFYYDVGRCPVKTCAGQQDNGIRCRDAVQNCCGISKTEEREIQCSGYTLPTKVAKECSCQRCTETRS    421 - 490
IVRGRVSAADNGEPMRFGHVYMGNSRVSMTGYKGTFTLHVPQDTERLVLTFVDRLQKFVNTTKVLPFNKK    491 - 560
GSAVFHEIKMLRRKKPITLEAMETNIIPLGEVVGEDPMAELEIPSRSFYRQNGEPYIGKVKASVTFLDPR    561 - 630
NISTATAAQTDLNFINDEGDTFPLRTYGMFSVDFRDEVTSEPLNAGKVKVHLDSTQVKMPEHISTVKLWS    631 - 700
LNPDTGLWEEEGDFKFENQRRNKREDRTFLVGNLEIRERRLFNLDVPESRRCFVKVRAYRSERFLPSEQI    701 - 770
QGVVISVINLEPRTGFLSNPRAWGRFDSVITGPNGACVPAFCDDQSPDAYSAYVLASLAGEELQAVESSP    771 - 840
KFNPNAIGVPQPYLNKLNYRRTDHEDPRVKKTAFQISMAKPRPNSAEESNGPIYAFENLRACEEAPPSAA    841 - 910
HFRFYQIEGDRYDYNTVPFNEDDPMSWTEDYLAWWPKPMEFRACYIKVKIVGPLEVNVRSRNMGGTHRQT    911 - 980
VGKLYGIRDVRSTRDRDQPNVSAACLEFKCSGMLYDQDRVDRTLVKVIPQGSCRRASVNPMLHEYLVNHL    981 - 1050
PLAVNNDTSEYTMLAPLDPLGHNYGIYTVTDQDPRTAKEIALGRCFDGTSDGSSRIMKSNVGVALTFNCV   1051 - 1120
ERQVGRQSAFQYLQSTPAQSPAAGTVQGRVPSRRQQRASRGGQRQGGVVASLRFPRVAQQPLIN         1121 - 1184
//

Text Mined References (26)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
22107760 2011 Genetic susceptibility of intervertebral disc degeneration among young Finnish adults.
20724643 2010 Cartilage intermediate layer protein gene is associated with lumbar disc degeneration in male, but not female, collegiate athletes.
19569011 2009 The cartilage intermediate layer protein gene is associated with lumbar disc degeneration in collegiate judokas.
17220213 2007 Phenotypic and population differences in the association between CILP and lumbar disc disease.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16453284 2006 Reproducible genetic associations between candidate genes and clinical knee osteoarthritis in men and women.
16413503 2006 Transcriptional regulation of the cartilage intermediate layer protein (CILP) gene.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...