Property Summary

NCBI Gene PubMed Count 27
PubMed Score 33.65
PubTator Score 33.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma 1.200 1.2e-03
Atopic dermatitis -1.900 9.1e-04
autosomal dominant Emery-Dreifuss muscul... 1.423 1.9e-03
Becker muscular dystrophy 1.401 6.9e-05
Breast cancer 2.000 5.6e-06
colon cancer -2.600 9.7e-03
diabetes mellitus -1.300 1.6e-03
Duchenne muscular dystrophy 1.671 1.4e-10
facioscapulohumeral dystrophy 2.100 8.1e-03
fibroadenoma -1.600 2.1e-02
intraductal papillary-mucinous adenoma (... -1.600 2.6e-04
intraductal papillary-mucinous carcinoma... -1.700 5.3e-04
intraductal papillary-mucinous neoplasm ... -1.600 5.8e-03
limb girdle muscular dystrophy 2A 1.370 5.6e-06
lung adenocarcinoma 1.200 9.0e-06
medulloblastoma, large-cell 1.300 8.1e-06
osteosarcoma 2.678 1.3e-04
ovarian cancer 3.200 3.2e-06
psoriasis -1.500 9.7e-15
spina bifida -1.509 4.7e-02

Gene RIF (10)

AA Sequence

MVGTKAWVFSFLVLEVTSVLGRQTMLTQSVRRVQPGKKNPSIFAKPADTLESPGEWTTWFNIDYPGGKGD      1 - 70
YERLDAIRFYYGDRVCARPLRLEARTTDWTPAGSTGQVVHGSPREGFWCLNREQRPGQNCSNYTVRFLCP     71 - 140
PGSLRRDTERIWSPWSPWSKCSAACGQTGVQTRTRICLAEMVSLCSEASEEGQHCMGQDCTACDLTCPMG    141 - 210
QVNADCDACMCQDFMLHGAVSLPGGAPASGAAIYLLTKTPKLLTQTDSDGRFRIPGLCPDGKSILKITKV    211 - 280
KFAPIVLTMPKTSLKAATIKAEFVRAETPYMVMNPETKARRAGQSVSLCCKATGKPRPDKYFWYHNDTLL    281 - 350
DPSLYKHESKLVLRKLQQHQAGEYFCKAQSDAGAVKSKVAQLIVIASDETPCNPVPESYLIRLPHDCFQN    351 - 420
ATNSFYYDVGRCPVKTCAGQQDNGIRCRDAVQNCCGISKTEEREIQCSGYTLPTKVAKECSCQRCTETRS    421 - 490
IVRGRVSAADNGEPMRFGHVYMGNSRVSMTGYKGTFTLHVPQDTERLVLTFVDRLQKFVNTTKVLPFNKK    491 - 560
GSAVFHEIKMLRRKKPITLEAMETNIIPLGEVVGEDPMAELEIPSRSFYRQNGEPYIGKVKASVTFLDPR    561 - 630
NISTATAAQTDLNFINDEGDTFPLRTYGMFSVDFRDEVTSEPLNAGKVKVHLDSTQVKMPEHISTVKLWS    631 - 700
LNPDTGLWEEEGDFKFENQRRNKREDRTFLVGNLEIRERRLFNLDVPESRRCFVKVRAYRSERFLPSEQI    701 - 770
QGVVISVINLEPRTGFLSNPRAWGRFDSVITGPNGACVPAFCDDQSPDAYSAYVLASLAGEELQAVESSP    771 - 840
KFNPNAIGVPQPYLNKLNYRRTDHEDPRVKKTAFQISMAKPRPNSAEESNGPIYAFENLRACEEAPPSAA    841 - 910
HFRFYQIEGDRYDYNTVPFNEDDPMSWTEDYLAWWPKPMEFRACYIKVKIVGPLEVNVRSRNMGGTHRQT    911 - 980
VGKLYGIRDVRSTRDRDQPNVSAACLEFKCSGMLYDQDRVDRTLVKVIPQGSCRRASVNPMLHEYLVNHL    981 - 1050
PLAVNNDTSEYTMLAPLDPLGHNYGIYTVTDQDPRTAKEIALGRCFDGTSDGSSRIMKSNVGVALTFNCV   1051 - 1120
ERQVGRQSAFQYLQSTPAQSPAAGTVQGRVPSRRQQRASRGGQRQGGVVASLRFPRVAQQPLIN         1121 - 1184
//

Text Mined References (30)

PMID Year Title