Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.41
PubTator Score 0.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -1.900 0.000
astrocytic glioma -1.700 0.007
posterior fossa group B ependymoma -3.300 0.000
oligodendroglioma -1.400 0.049
psoriasis -1.100 0.014
glioblastoma -3.400 0.000
osteosarcoma -2.745 0.000
medulloblastoma -2.200 0.000
atypical teratoid / rhabdoid tumor -3.600 0.000
medulloblastoma, large-cell -2.900 0.000
primitive neuroectodermal tumor -2.600 0.000
juvenile dermatomyositis 1.412 0.000
lung cancer 2.000 0.001
pediatric high grade glioma -2.800 0.000
pilocytic astrocytoma -2.300 0.000
subependymal giant cell astrocytoma -3.388 0.012
Pick disease -1.900 0.002
Breast cancer 1.300 0.000

Gene RIF (3)

PMID Text
21829649 presence of Liprin-alpha4 and nickel increased tyrosine phosphatase activity that reduced the global levels of tyrosine phosphorylation in the cell
20599943 liprin-alpha4 is a hypoxia-induced gene potentially involved in cell-cell adhesion
19536175 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MCEVMPTINEGDRLGPPHGADADANFEQLMVNMLDEREKLLESLRESQETLAATQSRLQDAIHERDQLQR      1 - 70
HLNSALPQEFATLTRELSMCREQLLEREEEISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQS     71 - 140
PSGVSSEVEVLKALKSLFEHHKALDEKVRERLRAALERVTTLEEQLAGAHQQVSALQQGAGVRDGAAEEE    141 - 210
GTVELGPKRLWKEDTGRVEELQELLEKQNFELSQARERLVTLTTTVTELEEDLGTARRDLIKSEELSSKH    211 - 280
QRDLREALAQKEDMEERITTLEKRYLAAQREATSIHDLNDKLENELANKESLHRQCEEKARHLQELLEVA    281 - 350
EQKLQQTMRKAETLPEVEAELAQRIAALTKAEERHGNIEEHLRQLEGQLEEKNQELARTAVQVRQREKMN    351 - 420
EDHNKRLSDTVDRLLSESNERLQLHLKERMAALEEKNTLIQELESSQRQIEEQHHHKGRLSEEIEKLRQE    421 - 490
VDQLKGRGGPFVDGVHSRSHMGSAADVRFSLGTTTHAPPGVHRRYSALREESAKLALPLTVTLRSPTWMR    491 - 560
MSQGVCCNLEYHSSGTLCGSSGPLPVPEMIQEEKESTELRAEEIETRVTSGSMEALNLKQLRKRGSIPTS    561 - 630
LTALSLASASPPLSGRSTPKLTSRSAAQDLDRMGVMTLPSDLRKHRRKLLSPVSREENREDKATIKCETS    631 - 700
PPSSPRTLRLEKLGHPALSQEEGKSALEDQGSNPSSSNSSQDSLHKGAKRKGIKSSIGRLFGKKEKGRLI    701 - 770
QLSRDGATGHVLLTDSEFSMQEPMVPAKLGTQAEKDRRLKKKHQLLEDARRKGMPFAQWDGPTVVSWLEL    771 - 840
WVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNALHRLKLRLAIQEMVSLTSPSAPPTSRTSSGN    841 - 910
VWVTHEEMETLETSTKTDSEEGSWAQTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTK    911 - 980
KDLRVHLKMVDSFHRTSLQYGIMCLKRLNYDRKELEKRREESQHEIKDVLVWTNDQVVHWVQSIGLRDYA    981 - 1050
GNLHESGVHGALLALDENFDHNTLALILQIPTQNTQARQVMEREFNNLLALGTDRKLDDGDDKVFRRAPS   1051 - 1120
WRKRFRPREHHGRGGMLSASAETLPAGFRVSTLGTLQPPPAPPKKIMPEAHSHYLYGHMLSAFRD        1121 - 1185
//

Text Mined References (16)

PMID Year Title
21829649 2011 Liprin-?4 is required for nickel induced receptor protein tyrosine phosphatase-leukocyte antigen related receptor F (RPTP-LAR) activity.
20599943 2010 Liprin-?4 is a new hypoxia-inducible target gene required for maintenance of cell-cell contacts.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19013515 2009 The mouse and human Liprin-alpha family of scaffolding proteins: genomic organization, expression profiling and regulation by alternative splicing.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15217342 2004 The synaptic vesicle cycle.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...