Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.07
PubTator Score 0.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -2.700 1.9e-04
astrocytic glioma -1.700 7.4e-03
Astrocytoma, Pilocytic -2.300 6.4e-07
atypical teratoid / rhabdoid tumor -3.600 2.5e-10
Breast cancer 1.300 3.9e-04
ependymoma -1.800 1.1e-02
glioblastoma -2.200 2.0e-06
group 3 medulloblastoma -2.100 1.8e-02
juvenile dermatomyositis 1.412 8.2e-06
lung cancer 2.000 1.4e-03
malignant mesothelioma -1.900 1.4e-05
medulloblastoma, large-cell -2.900 3.0e-04
oligodendroglioma -1.400 4.9e-02
osteosarcoma -2.745 4.2e-04
Pick disease -1.900 1.5e-03
primitive neuroectodermal tumor -2.600 1.6e-04
psoriasis -1.100 1.4e-02
subependymal giant cell astrocytoma -3.388 1.2e-02

Protein-protein Interaction (3)

Gene RIF (4)

AA Sequence

MCEVMPTINEGDRLGPPHGADADANFEQLMVNMLDEREKLLESLRESQETLAATQSRLQDAIHERDQLQR      1 - 70
HLNSALPQEFATLTRELSMCREQLLEREEEISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQS     71 - 140
PSGVSSEVEVLKALKSLFEHHKALDEKVRERLRAALERVTTLEEQLAGAHQQVSALQQGAGVRDGAAEEE    141 - 210
GTVELGPKRLWKEDTGRVEELQELLEKQNFELSQARERLVTLTTTVTELEEDLGTARRDLIKSEELSSKH    211 - 280
QRDLREALAQKEDMEERITTLEKRYLAAQREATSIHDLNDKLENELANKESLHRQCEEKARHLQELLEVA    281 - 350
EQKLQQTMRKAETLPEVEAELAQRIAALTKAEERHGNIEEHLRQLEGQLEEKNQELARTAVQVRQREKMN    351 - 420
EDHNKRLSDTVDRLLSESNERLQLHLKERMAALEEKNTLIQELESSQRQIEEQHHHKGRLSEEIEKLRQE    421 - 490
VDQLKGRGGPFVDGVHSRSHMGSAADVRFSLGTTTHAPPGVHRRYSALREESAKLALPLTVTLRSPTWMR    491 - 560
MSQGVCCNLEYHSSGTLCGSSGPLPVPEMIQEEKESTELRAEEIETRVTSGSMEALNLKQLRKRGSIPTS    561 - 630
LTALSLASASPPLSGRSTPKLTSRSAAQDLDRMGVMTLPSDLRKHRRKLLSPVSREENREDKATIKCETS    631 - 700
PPSSPRTLRLEKLGHPALSQEEGKSALEDQGSNPSSSNSSQDSLHKGAKRKGIKSSIGRLFGKKEKGRLI    701 - 770
QLSRDGATGHVLLTDSEFSMQEPMVPAKLGTQAEKDRRLKKKHQLLEDARRKGMPFAQWDGPTVVSWLEL    771 - 840
WVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNALHRLKLRLAIQEMVSLTSPSAPPTSRTSSGN    841 - 910
VWVTHEEMETLETSTKTDSEEGSWAQTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTK    911 - 980
KDLRVHLKMVDSFHRTSLQYGIMCLKRLNYDRKELEKRREESQHEIKDVLVWTNDQVVHWVQSIGLRDYA    981 - 1050
GNLHESGVHGALLALDENFDHNTLALILQIPTQNTQARQVMEREFNNLLALGTDRKLDDGDDKVFRRAPS   1051 - 1120
WRKRFRPREHHGRGGMLSASAETLPAGFRVSTLGTLQPPPAPPKKIMPEAHSHYLYGHMLSAFRD        1121 - 1185
//

Text Mined References (17)

PMID Year Title