Property Summary

NCBI Gene PubMed Count 17
PubMed Score 2.81
PubTator Score 2.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -3.100 3.4e-05
astrocytic glioma -2.300 5.2e-04
Astrocytoma, Pilocytic -2.100 8.1e-06
atypical teratoid / rhabdoid tumor -4.500 1.1e-09
ependymoma -2.300 6.8e-04
glioblastoma -2.900 3.8e-08
group 4 medulloblastoma -3.000 3.8e-05
medulloblastoma, large-cell -3.000 2.8e-04
oligodendroglioma -2.000 3.7e-03
ovarian cancer -1.400 7.3e-06
Pick disease -1.600 1.2e-03
pituitary cancer -1.200 4.2e-02
primitive neuroectodermal tumor -2.800 3.6e-03

Protein-protein Interaction (3)

Gene RIF (6)

AA Sequence

MMCEVMPTINEDTPMSQRGSQSSGSDSDSHFEQLMVNMLDERDRLLDTLRETQESLSLAQQRLQDVIYDR      1 - 70
DSLQRQLNSALPQDIESLTGGLAGSKGADPPEFAALTKELNACREQLLEKEEEISELKAERNNTRLLLEH     71 - 140
LECLVSRHERSLRMTVVKRQAQSPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLERVSALEEELA    141 - 210
AANQEIVALREQNVHIQRKMASSEGSTESEHLEGMEPGQKVHEKRLSNGSIDSTDETSQIVELQELLEKQ    211 - 280
NYEMAQMKERLAALSSRVGEVEQEAETARKDLIKTEEMNTKYQRDIREAMAQKEDMEERITTLEKRYLSA    281 - 350
QRESTSIHDMNDKLENELANKEAILRQMEEKNRQLQERLELAEQKLQQTMRKAETLPEVEAELAQRIAAL    351 - 420
TKAEERHGNIEERMRHLEGQLEEKNQELQRARQREKMNEEHNKRLSDTVDRLLTESNERLQLHLKERMAA    421 - 490
LEEKNVLIQESETFRKNLEESLHDKERLAEEIEKLRSELDQLKMRTGSLIEPTIPRTHLDTSAELRYSVG    491 - 560
SLVDSQSDYRTTKVIRRPRRGRMGVRRDEPKVKSLGDHEWNRTQQIGVLSSHPFESDTEMSDIDDDDRET    561 - 630
IFSSMDLLSPSGHSDAQTLAMMLQEQLDAINKEIRLIQEEKESTELRAEEIENRVASVSLEGLNLARVHP    631 - 700
GTSITASVTASSLASSSPPSGHSTPKLTPRSPAREMDRMGVMTLPSDLRKHRRKIAVVEEDGREDKATIK    701 - 770
CETSPPPTPRALRMTHTLPSSYHNDARSSLSVSLEPESLGLGSANSSQDSLHKAPKKKGIKSSIGRLFGK    771 - 840
KEKARLGQLRGFMETEAAAQESLGLGKLGTQAEKDRRLKKKHELLEEARRKGLPFAQWDGPTVVAWLELW    841 - 910
LGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTSRTPSGNV    911 - 980
WVTHEEMENLAAPAKTKESEEGSWAQCPVFLQTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARM    981 - 1050
LDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKRLNYDRKELERRREASQHEIKDVLVWSNDRVIRWIQAI   1051 - 1120
GLREYANNILESGVHGSLIALDENFDYSSLALLLQIPTQNTQARQILEREYNNLLALGTERRLDESDDKN   1121 - 1190
FRRGSTWRRQFPPREVHGISMMPGSSETLPAGFRLTTTSGQSRKMTTDVASSRLQRLDNSTVRTYSC      1191 - 1257
//

Text Mined References (20)

PMID Year Title