Property Summary

NCBI Gene PubMed Count 11
Grant Count 4
Funding $164,500.6
PubMed Score 5.85
PubTator Score 4.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Synonym

Accession O75333 Q14D64 Q86XS3 T-box protein 10
Symbols TBX7
TBX13

Gene

PANTHER Protein Class (1)

Gene RIF (6)

PMID Text
20672350 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20572854 Observational study of gene-disease association. (HuGE Navigator)
20544801 Observational study of gene-disease association. (HuGE Navigator)
16327884 Observational study of gene-disease association. (HuGE Navigator)
16247549 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAFLSAGLGILAPSETYPLPTTSSGWEPRLGSPFPSGPCTSSTGAQAVAEPTGQGPKNPRVSRVTVQLE      1 - 70
MKPLWEEFNQLGTEMIVTKAGRRMFPPFQVKILGMDSLADYALLMDFIPLDDKRYRYAFHSSAWLVAGKA     71 - 140
DPATPGRVHFHPDSPAKGAQWMRQIVSFDKLKLTNNLLDDNGHIILNSMHRYQPRFHVVFVDPRKDSERY    141 - 210
AQENFKSFIFTETQFTAVTAYQNHRITQLKIASNPFAKGFRESDLDSWPVAPRPLLSVPARSHSSLSPCV    211 - 280
LKGATDREKDPNKASASTSKTPAWLHHQLLPPPEVLLAPATYRPVTYQSLYSGAPSHLGIPRTRPAPYPL    281 - 350
PNIRADRDQGGLPLPAGLGLLSPTVVCLGPGQDSQ                                       351 - 385
//

Text Mined References (12)

PMID Year Title
20672350 2010 Genetic variants in COL2A1, COL11A2, and IRF6 contribute risk to nonsyndromic cleft palate.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20572854 2010 MTHFR and MSX1 contribute to the risk of nonsyndromic cleft lip/palate.
20544801 2010 Association between genetic variants of reported candidate genes or regions and risk of cleft lip with or without cleft palate in the polish population.
16327884 2005 Medical sequencing of candidate genes for nonsyndromic cleft lip and palate.
16285859 2005 T-box genes in vertebrate development.
16247549 2006 PAX9 and TGFB3 are linked to susceptibility to nonsyndromic cleft lip with or without cleft palate in the Japanese: population-based and family-based candidate gene analyses.
15703190 2005 Identification of a novel nuclear localization signal in Tbx1 that is deleted in DiGeorge syndrome patients harboring the 1223delC mutation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12915323 2003 The T-box gene Tbx10 exhibits a uniquely restricted expression pattern during mouse embryogenesis.
More...